araal-a0a087gp92

Arabis alpina (Alpine rock-cress). Uncharacterized protein

Comment

Relationship

Family : Chlorophyllase_Plant

Block : L

Position in NCBI Life Tree : Arabis alpina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSSSSSSNVFEDGKYKTNLLTINSSSRCCKATPSSPSPSP
PKQLLVATPV KEGEYPVVMLLHGYLLYNSFYSQLMLHVS
SHGFILIAPQLYSIAGPDTTD EIKSTAETIDWLAVGLKH
FLPPQVIPNLAKLALSGHSRGGKTAFAVALEK FGYSPKL
KIKTLIGIDPVDGMAKGKQTPPPVLTYEPNSFDLDKMPVL
VIG SGLGETARNPLFPPCAPPGVNHRDFFRECQGPAWHF
VAKDYGHLDMLDDE TKGIRGKSSYCLCKNGEERRPMRRF
VGGIVVSFLKAYLEGDDCELVKIKD GCHKGLPVEIQEFE
VTM

References

No reference