araal-a0a087gql4

Arabis alpina (Alpine rock-cress) Putative uncharacterized protein

Comment

Relationship

Family : Duf_1350

Block : X

Position in NCBI Life Tree : Arabis alpina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MATCGLWTSPSFSPRRQFCSFSCSRRSLSPVLRFGKERRV
SCSYEEKERD RPQSSGIQVYGEIERLLTETVKQSQSNSA
GSSDWSEVEGAWVLKPRNSKP KMVAHFVGGIFVGAAPQL
TYRLFLERLADKDVLVIATPYASGFDHFLIAD EVQFKFD
RCCRYLQDIVHDLPSFGIGHSLGSVIHLLIGSRYAVQRSG
NVF MAFNNKEASLSIPLLSPVLVPMAQRLGPLLSQVATS
PTVRLGAEMTRKQL ETNSPPIMKQILPLVEQLPPLYMDL
VKGREDFIPKPEETRRLIRSYYGIS RNLLIKFEDDSIDE
TSILAQVLGVESSISSKLDMSIRTLPGDHGLPLQQT LPD
VPPAMVDVVNRGSEFLANIAVGTPWESVAKEVGSSLGKDS
KILRAEM SKDLILLVDAVTSWMASNMGPKLLRP

References

No reference