araal-a0a087gvf0

Arabis alpina (Alpine rock-cress) Putative uncharacterized protein

Comment

"Alpine rock-cress"

Relationship

Family : Duf_1350

Block : X

Position in NCBI Life Tree : Arabis alpina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MELGLCASSFLGNQMVPATQFCRGTRAVSLTVTASGSYNR
RNDKIYTRLD TCLVIPPPPRFKKPRAIVKFLGGAFVGAV
PELTYSYLKELLAKEGYLIVS VPYNVTFDHEQAAKQVYE
RFNSCLDLILSSGIPSSNFKPQDLAHLPLFSV GHSNGAL
LQALTGSYFAEKIPKANAIISFNNKSATEAVPYFEQLGPL
IQQ MMPVVEASPVYEMARNASGDVLKGLLDTVGATILNN
DQEALKSFTKLVDQ LPSVFGEVGQGVSEFRPSPLENRNR
FKCSYSVPHTLLVQFNSDAIDETDV LEETLRPRIESIGG
TLEKVRLNGNHLTPCIQDPKWQTGYAYTPADAVAQA LKT
IPLSETRVLSRTIVDWFRRFED

References

No reference