bacpn-d5n5c3

Bacillus subtilis subsp. spizizenii Putative proline iminopeptidase

Comment

"Other strains: Bacillus subtilis subsp. spizizenii (strain ATCC 6633\; ATCC 23059 \/ NRRL B-14472 \/ W23)"

Relationship

Family : Proline_iminopeptidase

Block : X

Position in NCBI Life Tree : Bacillus subtilis subsp. spizizenii ATCC 6633

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MIPEKRSIAIMKELSIGNTKQMLMINGADVKNPLLLFLHG
GPGAPQIGYV RHYQKELEQHFTIVHWDQRGSGLSYSKRI
PHHSMTISHFIKDTIQVTQWL LDHFSKTKVYLAGHSWGT
LLALHVLQQRPDLFYAYYGISQVVNPHYEESA AYQYIRE
ISDPKRAGIVFPLIRFIGAPPWKKDIQHLIYRLCVEMSRG
GFT HQHRQSLAILFQMLTGKEYGIRNMHSFLNGLYFSKK
HLTDELYRFNAFRS VPSIKVPCCFISGRHDLIVPAEISK
QYYCELEAPEKRWFQFEKSAHTPHI EEPSLFANTLSRHA
LYHL

References

No reference