betvu-a0a0j8bea4

Beta vulgaris subsp.vulgaris, Putative uncharacterized protein

Comment

Relationship

Family : Duf_1350

Block : X

Position in NCBI Life Tree : Beta vulgaris subsp. vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MDVACCISASRLHKIPLFSSSFLQTPISLLLQPIHRISFK
RLRSAPVYCN SEPPTSLTRTSDSTAIQVYRDFERLITEV
VKQSQDSLGGASNWSEVEGAW VLEPRNSRPWSVVHFIGG
IFVGAAPQLAYRLFLERLCEKGILIIATPYAS GFDHSSI
ADEVQFKFDRCLRSLRETIDKLPTFGIGHSLGSVVHLLIG
SRY AVQRNGNILMAFNNKDPSQAIPLFSPIFLPMTQSMG
PLLSQIASAETIRL GAETTLKQLENLSPPIMKQVLPLFE
QLPPLYMDLAKGRENFSPKPEETRR LIKTYYGINRNLLI
KFKDDIIDETSVLAQVLTVDSAISSMLDMSIRTVPG DHG
TPLQQALPDVPPAMADAVNRGSELLSNLIAGTPWETVAKD
VSTLLGM DSQILRAESSKDLEHLVDVVSSWMSSSIVPEL
PR

References

No reference