eubma-a0a098lwp6

Eublepharis macularius (Leopard gecko) butyrylcholinesterase

Comment

Relationship

Family : BCHE

Block : C

Position in NCBI Life Tree : Eublepharis macularius

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MICANGACRHIRIIIWFLLLYILVKKVVPEDDTEVATKSG
RVKGVNLPAL GGIVTAFLGIPYGEPPTGTLRFKKPQPKK
QWTVVWDATKHSNSCYQNIDS TFPGFAGSEMWNPNTNLS
EDCLYLNVWVPSPKPKNASVMVWIYGGGFQSG TSTLPVY
DGKFLARVERVIVVSLNYRLGALGFLALPGNEEAPGNAGL
FDQ RLALQWVQDNIAAFGGNSKSVTIFGESAGAGAVSYH
LLSPKSYPLFTRAI MQSGAGNAPWGALLPSEARRRTLAL
AHLLQCTSSNEVEIIHCLQSKHPQD ILSNEVSVLMYSSL
LELYFIPVVDGDFLTEMPETLLKNGKFKQTQILMGV NKD
EGAVFLAYGAPGFSKDNNSLINDADFRAGLKFSFPEMNDL
SLESVHF HYTDWEDEENPFNYRDAMDDVFGDYNFICPVV
KFIKHFVEAGNTAFLYFF EHRSSKLPWPEWMGVLHGYEI
EFVFGLPLERRANYTKAEEILSRSMMRYW ASFAKTGTPN
GTQINGTRWPVFTTTEQKYLTLSTEASKIRRKLRARQCRF
WDIFFPEVLEMTGNIDEAEREWKAGFLRWNNYMMDWKNQ
FNDYTSRKEGC TGL

References

No reference