eubma-a0a098ly51

Eublepharis macularius (Leopard gecko) acetylcholinesterase

Comment

Relationship

Family : ACHE

Block : C

Position in NCBI Life Tree : Eublepharis macularius

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MPQNQGSAMPKGRSWVQNHHRHLLLLSLAVAVSAQSDELT
VNTQAGRLRG TRMAVLDGHVSAFLGIPFAEPPVGRLRFL
RPEPKKPWSGIREASSYQHAC YQFVDKMYPGFHGTEMWN
PNQEMSEDCLYLNIWVPSPRPKNATVLVWIYG GGFYSGS
SSLDVYDGRFLTYTENVVLVSLSYRVGAFGFLALLESPEA
PGN VGLLDQRLALQWIQNNIHSFGGNPKLITIFGESAGA
ASVGMHLLSAQSRD LFKRAILQSGTPNGPWATITPAESR
RRATHLAKLVGCHSTNDSEMVSCLR TKEPQELIDKEWLV
LPYDSVFRFSFVPVIDGDFFPDTAEAMLNTRNFKET QIL
LGVVKDEGSYFLLYGAPGFSKDNDSLISREDFLDGVRIGV
PQANEIA AEAVVLQYTDWKDENNREKNREAMDDIVGDHN
VICPVMHFAARYAEHGNK VYAYLFDHRASNLIWPLWMGV
PHGYEIEFVFGLPLNSSLNYTEEEKELSR RMMRYWANFA
RTGDPTEPSEKGQVWPPYTVSEQKYVKLNTQPLVVDRSLR
AQICAFWNRFLPKLLNVTDNIEEAERQWKVEFHRWSSYM
MHWKNQFDHYY SKQERCSEL

References

No reference