frave-FanCXE1

Fragaria vesca subsp. vesca 2-hydroxyisoflavanone dehydratase-like FanCXE1

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Fragaria vesca subsp. vesca

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Interpro

No Pfam

No UniProt

No PIRSF

No SUPERFAM

Sequence

Peptide

MASTTKEIVSEIPNLIKHYKDGTVERLIADPHVPPSLNDP
QTGVSSKDIT ISHNPLVSARLYLPAQNQSQKQLPIFVYF
HAGGFFCSSAFSFYHHRYLNR LVSEAQVIAVSVEYRLAP
ESPLPAAYEDSWLSLQWVASHSLHEDDTCNNK EPWLADF
GDFDRVYIGGDSAGGNISHNIAIKAGVESLNGGVKILGAI
LSH SGFWGSTPIGSEPRGEDFEKSLSYLVLKFSFPCADG
GLDNPMINPMAPGA PSLAGLECSRLLVCVAGKDELRDRN
LWYYASVKESGWKGEAELFEVEEGE HCFHIASDEVTENV
KKMIKRMADFLV

References

Title : Strawberry fruit FanCXE1 carboxylesterase is involved in the catabolism of volatile esters during the ripening process - Martinez-Rivas_2022_Hortic.Res_9_uhac095
Author(s) : Martinez-Rivas FJ , Blanco-Portales R , Moyano E , Alseekh S , Caballero JL , Schwab W , Fernie AR , Munoz-Blanco J , Molina-Hidalgo FJ
Ref : Hortic Res , 9 :uhac095 , 2022
Abstract : Martinez-Rivas_2022_Hortic.Res_9_uhac095
ESTHER : Martinez-Rivas_2022_Hortic.Res_9_uhac095
PubMedSearch : Martinez-Rivas_2022_Hortic.Res_9_uhac095
PubMedID: 35795396
Gene_locus related to this paper: frave-FanCXE1