fusox-w9nll6

Fusarium oxysporum f. sp.. Uncharacterized protein

Comment

"Other strains: Fusarium oxysporum f. sp. (pisi HDV247\; raphani 54005\; conglutinans race 2 54008\; vasinfectum 25433)"

Relationship

Family : Fungal_carboxylesterase_lipase

Block : C

Position in NCBI Life Tree : Fusarium oxysporum f. sp. pisi HDV247

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKYSIFISLTALITGTLSKPPSLTRPPTVTVKNGTYIGTH
SSSYNQDFFL GIPYAQPPVKNLRFNTAQSLNTTWTGKKP
ANSYSAACIGYGTDNAGYKNT SEDCLYLNIVRPSERRRM
LPVLVWIHGGGLVEGSAIDQRYNLSFVVRQSE AIGMPII
GISLNYRLGALGFLNSDEVAKTGNTNLGFKDQRLALRWVQ
ENI PAFGGDPEQVTIWGESAGAFSVGAHLTAFGGRDDRL
FRGAIMDSGNPVFY LPVFPAQYFQPSYEALLKMTGCNNS
ADGLECLRQVPIAELSKVFHASPSL WSGFTPSKDGDFIQ
GSGSELLSKGKFVHVPILIGTNTDEGTYFASKDPTP KNI
SSDAEFISYLQGNNQHLPTPFIQEVLRAYPDVPSEGIPGV
PTLPASY RPGYPYGSQWRRLAAYCGDSVIIANKRWTSQI
WSSAGLCVYSYRFNIVPA SIPGVFGASHVQEIPFAFYNH
NGIGYNKENMSPWNGTEEPFEDKRADYAE AARLMSSLWV
SFVHDQDPNSFGRGGCGIGNRSVPLWPTYTKGGKNGTNFV
FSSAFEFYLEPDNFRFNAINLLMSRNEKSHTQE

References

No reference