fusox-w9nsh4

Fusarium oxysporum f. sp. pisi HDV247. Uncharacterized protein

Comment

Relationship

Family : Fungal_carboxylesterase_lipase

Block : C

Position in NCBI Life Tree : Fusarium oxysporum f. sp. pisi HDV247

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

TISHESLNAALTGLRTSDVIQFRGIPYGQIPRRFAAPEKL
QKYPRFLDCT NFGPRCPQVAVDVGHLLRIPPDHTFPDEP
EDEFKCTNLDVVLPDSGPDVI NSNLPVLVWIHGGSQAVT
FGSAASGVCDMSKIVADSLRLGKPIIAVSVQY RLNVFAL
GNGEGPPNLALRDQELALQWVQDHIAGFGGDPGKITLAGE
SAG AIYCHAHLVANARVRQVILSSGSLFLSSPQPWHLVA
SFRDKVSTNLKDMD QTLDLETASVSEVVEAVRRSGLQSF
FLEWEDPFNAWHTKTGCTERLLLSD VTKEGAIYQAGVWA
TEPSDIAKAFDASEQYGDELKKLYHIYPGRPSSCKT GAL
DFINDYKYLLPVQRLEKSFKDARKPVFRCLIDEANPWQPS
SGAHHAV DLVLLFGGFDLSFSPSAERVGQAMREAWIKFI
SGEEPWPEATEKYYGFGP HGSLKTLEDWEVQSRRRIGLA
EKLSEMESPFLDKTSRGLAAGKVSLLN

References

No reference