fusox-w9nxk0

Fusarium oxysporum f. sp. pisi HDV247 Uncharacterized protein

Comment

Relationship

Family : GTSAGmotif

Block : H

Position in NCBI Life Tree : Fusarium oxysporum f. sp. pisi HDV247

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVSLTEGQKATLSPEAVEFLTKIRHPPLANTLSSFITSPC
RVPGLRQGFT EKTAPGETQLIEKHKLQITETLIAGVSVV
VIEPPTIKPRKQKKILFNVFG GAFIMGSPSDRAALTMAI
ELGVRVYSIDYTKSPEVKYPEARDQCLAVYRE LLQKGPS
GGAPVDPSNIHAMGCSSGAQILVSMLLVARQQGLPMPSAG
MYL CTPALDLSGAGDSMVFNSLGRDIMPVSLLTGMVSQN
YAPEGINVTDPLYS PIYANYDSSFPPTVITVGTRDFALS
HGIRFYWKLREAGVKVELLVSEGMW HGFNWDPVIPESIR
ARAAVIKFLEDAR

References

No reference