lepsv-e2j7j8

Lepidium sativum (Garden cress) Gibberellin receptor 1b

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Lepidium sativum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAGGNEVNLNECKRIVPLNTWVLISNFKLAYNILRRPDGS
FNRDLAEFLD RKVPANAFPVDGVFSFDHVDSTTNLLTRI
YQPSSLFDQTLHGTVELTRPL STTEIIPVLIFFHGGSFT
HSSANSAIYDTFCRRLVSICGVVVVSVDYRRS PEHRYPC
AYDDGWNALKWVKSRIWLQSGKHSNVYVYLAGDSSGGNIA
HNV AVRATKEGVQVLGNILLHPMFGGQERTESEKGLDGK
YFVTIQDRDWYWRA YLPEGEDRDHPACNPFGRRGQSLKG
VNFPKSLVVVAGLDLVQDWQLAYVD GLKKTGHEVNLLYL
KQATIGFYFLPNNDHFHCLMEELNKFVHSIEDYERK SNP
VLLTL

References

Title : Members of the gibberellin receptor gene family GID1 (GIBBERELLIN INSENSITIVE DWARF1) play distinct roles during Lepidium sativum and Arabidopsis thaliana seed germination - Voegele_2011_J.Exp.Bot_62_5131
Author(s) : Voegele A , Linkies A , Muller K , Leubner-Metzger G
Ref : J Exp Bot , 62 :5131 , 2011
Abstract : Voegele_2011_J.Exp.Bot_62_5131
ESTHER : Voegele_2011_J.Exp.Bot_62_5131
PubMedSearch : Voegele_2011_J.Exp.Bot_62_5131
PubMedID: 21778177
Gene_locus related to this paper: lepsv-e2j7j8