nicat-a0a1j6ihc7

Nicotiana attenuata (Coyote tobacco) Uncharacterized protein

Comment

Relationship

Family : Duf_1350

Block : X

Position in NCBI Life Tree : Nicotiana attenuata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MASTSAAYITTFTSNLHEIKQKPFFPSKCTDLFRPFSPLK
LKNPEFFKFP KMSLSNDYVGIGSFNSTITNYNNATTAKF
YKRMDSCLVIPPPKGKKPKAI IKFVGGAFIGAVPEVSYS
YLLENLAREGYLIICVPYKVTFDHAQVTRQVF ERFHACF
GSILASGLPDSGLSAADIVDLPLYSVGHSNGALIQALTGS
YFC EKIPKANIIISYNNRPASEAVPYFEQLGLLVGQMIP
VISPVYSIAQSASG DALRVLLDTAGTIIPDYDPETVVSL
TKFADQLPSVFGELAQGISEFKPTP SENLECFKNSYNVK
RTLLVKFDSDTIDETDRLEETLKPRVESFGGKVEKI ALT
GNHITPCVQEPKWRVGAVYTPADAVAQVVKTVALNDTKGL
YTTIVNW LDRIEEF

References

No reference