nicat-a0a1j6k589

Nicotiana attenuata (Coyote tobacco). Chlorophyllase-2, chloroplastic

Comment

Relationship

Family : Chlorophyllase_Plant

Block : L

Position in NCBI Life Tree : Nicotiana attenuata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVISYSSSVTCSTTSITVFDLGNYKTKFVKIEPQTCDTDP
SPPKALLIAT PSEAGSYPVLIFLHGYLLYNSFYSQLIQQ
VSSHGFIVVAPQLYLVEGANA TEDIKSTAEITNWLAQGL
HHYLPSDVEPNLKKLGLAGHSRGGKVAFALAL RKISNIS
TNLKFSALIGVDPVDGMDKGKQTPPSVLTYTPHSFNLDMA
VMV IGSGLGEVKKNPLFPACAPNGVNHRDFYSECCKPAC
YFVAKDYGHNDMLD DETKGIRGKVTYCLCKKGKSREPMR
RFVGGVLVAFLEAYLEGKSSDLMAI RHGNITLPVELQDI
DFLV

References

No reference