nicat-a0a1j6kzj2

Nicotiana attenuata (Coyote tobacco). Chlorophyllase-2, chloroplastic

Comment

Relationship

Family : Chlorophyllase_Plant

Block : L

Position in NCBI Life Tree : Nicotiana attenuata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAKKVRDDGIALDFEVGDETVDIINVKRSSFSDLLPCPLL
VFSPTTQGSY PVLLFFHGFMLQPNWYKSLLLHISSHRYI
IVAPQFSPMVSQSQEVKNARK IVEWLSTNNLDSVLPEKV
FPDLQKVAVSGHSRGGKTAFALALGYGGGSST SNATQLE
PRLKISALLGIDPVAGSSTSCLCSPNILQFIPYSFDQSIP
VAV IGGGLSNQRAFGVCPPGAPNGVNHAEFFNESKPPCY
YFLAKDYGHLDMLD DGTAALIRWVMKSGKGSKDSMRRTV
GGLFVAFLKAYLEGQADDLINIVES PNVHAPITLDPVIS
VE

References

No reference