patfa-a0a1v4kp19

Patagioenas fasciata monilis. Arylacetamide deacetylase-like 4

Comment

Relationship

Family : Arylacetamide_deacetylase

Block : H

Position in NCBI Life Tree : Patagioenas fasciata monilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAVAYILLVLFLAVFVAGFILLVLGAINFDLSNSDIPSGV
DQPVKLRIIH IFVICIAVVGKILEKIGICSQFSFMRYIH
DRTHVGADPKLLIKNLWFDKV PVRIYQPKVPSANQRRGV
MFFHGGGWVLGSLEVHENICRFIARESESVVV SVGYRVA
PEHKYPAAYEDCLNATIHFMKNIEHYGVDPANVIVCGDSA
GGN LAAAVCQTLAGRSDLPKLRAQILIYPGLQALDFNLP
SYQQNRGVPLLYRE HAAFYVLQYLNGNLLHMQEVLDGSH
IPIDIKLKYRKWLSPDNIPEKFKIR GYKPHVLLDCTPEV
FEKVKGFCEPTLCPLLAEDAVIQQLPESFILTCEYD VLR
DDGLLYKKRLEDNGVPVTWCHLEDAFHGVICFLDNYVLSF
PAAKRGA DNIVSFLKSL

References

No reference