phavu-v7blh8

Phaseolus vulgaris (Kidney bean) (French bean). Uncharacterized protein

Comment

Relationship

Family : Chlorophyllase_Plant

Block : L

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MCSYICSYLSSTSVFDTGKYTTEILRVESESYTQNNVPPP
KPLLIATPHE AGEFSVLIFLHGYLLYNSFYSQLIQHVAS
HGFIVIAPQLYTVAGPDTSDE IHSAAAITNWLSEGLCKF
LPPNVIPNLNKVALSGHSRGGKTAFALSLRRL NISTDIK
FSALIGVDPVDGMDKGKQIPPPVLTYVPHSFDLDMPVMVI
GSG LGEVKRNPLFPPCAPKGVNHENFFKECKKPAWYFVA
KDYGHSDMLDDDTK GIRGKATYCLCKNGDSRKPMRRFVG
GVIVAFLKAYLQDDYGDLLAIRDMH VSLPLEFKFDSYV

References

No reference