phavu-v7cdy4

Phaseolus vulgaris (Kidney bean) (French bean). Uncharacterized protein

Comment

Relationship

Family : Maspardin-ACP33-SPG21_like

Block : X

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKSVFSAPGDYVHFKSQVPLHKIPIGTKQWRYYDFGPKAV
PPLICLPGTA GTADVYYKQIMSLSMKGYRVISVDIPRVW
NNTEWIQAFEKFLDAIDVHHI HLYGTSLGGFLAQLFAQH
RPRRVRSLVLSNTFLETRSFSAAIPWAPIVSW TPSFLLK
RYVLTGIRDGHHEPFIADSVDFVVSQVETLSREDLASRLS
LTT DDASVGPLLLSDSFITIMDTNDYCAIPQQLKDQLGE
RYPEARRAYLKTGG DFPFLSRPDEVNLHLQLHLRRVGVE
ARPDLVHNIPKGDLGGSPSKESNED DFDKSHEDDRGGSE
NSPAKYEINPTPESSGSSNLDKQPLDSSECCHLDHE PAL
YALPGGFTRRKNIVPPGTSVHFVWEYIATFHLLHYISSLY
IIWNYSS EFRQVV

References

No reference