phavu-v7cw16

Phaseolus vulgaris (Kidney bean) (French bean), Putative uncharacterized protein

Comment

Relationship

Family : Duf_1350

Block : X

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MEMASSSFVLGSDLKCILSSRNSTMSGFGALRHTQPNGLF
SKFFHFHTLS TRMVARTSKMVSNVFVGGDKSTRVNSKMY
TKLDSCLVVPPTPNPSKPRAI IKFLGGAFIGAVPEVTYG
YLIEFLAKEGFLVVVVPYNVTFDHSQAAKQVY ERFQACL
GTILTSGLPQANLSPAQLKDLPLFSVGHSNGALLQLLTGS
LYS EKIPKANAIISYNNRPATEAVPYFEQLGPAVSQMMP
VMEAAPFYSIARNA SGDALKVMLDAVRSTLQESEQEILN
SLTKFVDQLPSVMNEVSQGVSEFKP TPSENRDCFKCSYN
VEHTLLVKFNFDAIDETDILEETIKPRVESLGGTLE KVT
LSGNHITPCIQGARWEVGKLYTPADAVAQRLTSLSLNDTK
ILARTIS DWFRRYET

References

No reference