phavu-v7cye0

Phaseolus vulgaris (Kidney bean) (French bean). Peptidase_S9 domain-containing protein

Comment

Relationship

Family : Glutamyl_Peptidase_S9

Block : X

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MMRLHKLYHRFSLLPISPLSLSSNPSLLPLALPLRLRTAV
NFASMASSRL RNLAPLGAAPTEDSAASFSSSATAATSFD
YEDESTLGTKYRVPPPEISKI VDAPPVPALSFSPLRDKI
IFLKRRALPPLAEIARPEKKLAGVRIDGKCNT RSRMSFY
TGIGIHQILPDGTLGPEIEVHGFPDGAKINFVSWSPDGCH
LSF SIRVNEEDNDSSKLTVWIADVKTGKARQLFQSPNVH
LNAVFDNYVWVNNF SLLVCTIPSSRGAPPNKPLVPAGPK
IQSNEEKNIIQVRTFQDLLKDEYDE DLFDYYATSQLVLV
SLDGSAKEIAPPAVYTSMDPSPDHKYILISSIHRPY SFI
VPCGRFPKKVELWSAEGKLIRELCDLPLAEDIPIASNSVR
KGMRSIN WRADKPSTLYWVETQDGGDAKVEISPRDIVYT
QLAEPLEGEQPTIFHKLD FRYGGVSWCDDSLALVYESWY
KTRKIRTWLVSPGSEDVAPDILFDRSSED VYSDPGSPML
RRTQAGTYIIARIKKASDEGRYVILNGTGATPEGNIPFLD
LFDINTRKTERIWESDKEKYYETVVALMSDQEEGDLHLD
KLKILTSKESK TENTQYYFVGWPDKKIVQVTNFPHPYPQ
LASLQKEMVRYQRKDGVQLTAT LYLPPGYNPSTDGPLPC
LVWSYPGEFKSKDAAGQVRGSPNEFAGIGSTSA LLWLAR
RFAILSGPTIPIIGEGDEEANDSYVEQLVASAEAAVEEVI
RRGV ADPKKIAVGGHSYGAFMTANLLAHAPHLFCCGIAR
SGAYNRTLTPFGFQN EDRTLWEATNTYVEMSPFMSANKI
KKPILLIHGEEDNNPGTLTMQSDRFF NALKGHGALSRLV
ILPHESHGYTARESIMHVLWETDRWLHKHCVSNTSVA EE
DHETATVKEDVSKETTNAENKVVATSGGGSREVSELEYEE
FHSLPRRI IRT

References

No reference