spiol-a0a0k9qx78

Spinacia oleracea (Spinach), Putative uncharacterized protein

Comment

"Spinach"

Relationship

Family : Duf_1350

Block : X

Position in NCBI Life Tree : Spinacia oleracea

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MATSLISPSKSILSPFFTTPTKSSTPFSWKLSPIQKPHKI
SAPKLVSGGG FLERESSKSTFKLNSYSASSSSSSFGNVD
KKNGNITVDTCLVVPPPNSRK PRAIIKFLGGAFIGKVSQ
VTYSYLIELLAKEGYLVVLVPYNVTFNHEDAA RQVYERF
NACLDILLTCGLSDAKLDASQLVGLPVFSVGHSNGGLLQV
LTA SYFFDKIPKANAVVSFNNRPATEAVPYFEQLGPLMS
QVIPMVETNPMYSM ATSVSGDAWKALLDGAGAVMSQTDP
ELFSSVNQFVDQLPSVLNEVRQGVS EFRPTPAENRERCK
CSYNVPHTLLVKFSSDAIDETDLLEETLKPRVKSIG GTL
EKAQLSGNHLTPCIQDPKWQVGNLYTPVDAIAQGLKTISL
NDTKVLA QTITNWFRRFEE

References

No reference