strsw-c9ysy6

Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative uncharacterized protein

Comment

Relationship

Family : 6_AlphaBeta_hydrolase

Block : X

Position in NCBI Life Tree : Streptomyces scabies

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MNAPDTIVLIHGFWVTPRSWEHWIDRYEKQGYRVLAPAYP
GFEAEVESLN ADPSPIEAITAPRIVESLANVIRGLDKPP
VLIGHSAGGAFTQVLLDHGFG AAGVALNSAPTEGVRVAP
LSQLKATFPVLKNPANHHKAVGLTHEQWHYAF TNTFSEE
ESRALYERYAVPASGRILWNSVLANLQPGHQDIWVNYHND
DRA PLLFLSGELDHLMPPRIQQSNVKHYKSKTVTEIEVY
PGQPHLMPASPGWE EIADHALSWALSHAR

References

Title : Streptomyces scabies 87-22 contains a coronafacic acid-like biosynthetic cluster that contributes to plant-microbe interactions - Bignell_2010_Mol.Plant.Microbe.Interact_23_161
Author(s) : Bignell DR , Seipke RF , Huguet-Tapia JC , Chambers AH , Parry RJ , Loria R
Ref : Mol Plant Microbe Interact , 23 :161 , 2010
Abstract : Bignell_2010_Mol.Plant.Microbe.Interact_23_161
ESTHER : Bignell_2010_Mol.Plant.Microbe.Interact_23_161
PubMedSearch : Bignell_2010_Mol.Plant.Microbe.Interact_23_161
PubMedID: 20064060
Gene_locus related to this paper: strsw-c9z180 , strsw-c9ysy6 , strsw-c9ysy7 , strsw-c9ysz9 , strsw-c9yt44 , strsw-c9ytw9 , strsw-c9yu91 , strsw-c9yvs3 , strsw-c9ywr2 , strsw-c9yxp4 , strsw-c9yxp5 , strsw-c9yz19 , strsw-c9yzy1 , strsw-c9z0t6 , strsw-c9z3u6 , strsw-c9z3z0 , strsw-c9z6l3 , strsw-c9z486 , strsw-c9z724 , strsw-c9z895 , strsw-c9zb30 , strsw-c9zb72 , strsw-c9zby2 , strsw-c9zc13 , strsw-c9zcs0 , strsw-c9zeh4 , strsw-c9zg72 , strsw-c9zcr8 , strsw-c9zcj5 , strsw-c9z1u3 , strsc-a0a100jmt3 , strsw-c9yvp7 , strsw-c9yz80 , strsw-c9z9q3 , strsw-c9zg57