Gene_locus Report for: 9acto-b4v0r1Streptomyces sp. Mg1 Esterase Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces sp. Mg1: N E
6_AlphaBeta_hydrolase : 9acto-b4uwz1Streptomyces sp. Mg1 Putative uncharacterized protein, 9acto-b4uya8Streptomyces sp. Mg1 Putative uncharacterized protein, 9acto-b4v0f4Streptomyces sp. Mg1 Secreted protein, 9acto-b4v6d3Streptomyces sp. Mg1 Delta 12 desaturase, 9acto-b4v8d5Streptomyces sp. Mg1 Secreted protein, 9acto-b4v829Streptomyces sp. Mg1 Hydrolase, 9acto-b4vav7Streptomyces sp. Mg1 Alpha/beta hydrolase, 9acto-b4vdv5Streptomyces sp. Mg1 Alpha/beta hydrolase. A85-Est-Putative : 9acto-b4v1d0Streptomyces sp. Mg1 Putative uncharacterized protein, 9acto-b4v1d1Streptomyces sp. Mg1 Putative uncharacterized protein, 9acto-b4v4r1Streptomyces sp. Mg1 Putative uncharacterized protein, 9acto-b4vc03Streptomyces sp. Mg1 Putative uncharacterized protein. CarbLipBact_2 : 9acto-b4v3g7Streptomyces sp. (strains Mg1; C) Esterase/lipase. Carb_B_Bacteria : 9acto-b4vgs4Streptomyces sp. Mg1 Carboxylesterase, 9actn-a0a0g3utb4Streptomyces sp. Mg1. Carboxylic ester hydrolase, 9actn-a0a0g3uwf1Streptomyces sp. Mg1. Carboxylic ester hydrolase. CFTR-inhibitory-factor_Cif : 9acto-b4ux89Streptomyces sp. Mg1 Hydrolase. Chlorophyllase : 9actn-b4v8d1Streptomyces sp. Mg1. Putative uncharacterized protein, 9actn-b4vb55Streptomyces sp. Mg1. Putative uncharacterized protein. DLH-S : 9acto-b4uxl0Streptomyces sp. Mg1 Abhydrolase_5 and Phosphoribosyltransferase, 9acto-b4uyq8Streptomyces sp. Mg1 Phosphoribosyltransferase. DPP4N_Peptidase_S9 : 9acto-b4v7d0Streptomyces sp. Mg1 Peptidase S9B, 9acto-b4vd33Streptomyces sp. Mg1 Dipeptidyl-peptidase IV. Duf_1023 : 9acto-b4uz41Streptomyces sp. Mg1 Putative uncharacterized protein, 9acto-b4vcm0Streptomyces sp. Mg1 Putative uncharacterized protein. Epoxide_hydrolase : 9acto-b4v9q5Streptomyces sp. Mg1 Short chain dehydrogenase, 9acto-b4v119Streptomyces sp. Mg1 Epoxide hydrolase. Est9X : 9acto-b4v8t1Streptomyces sp. Mg1 Lipase/esterase. Haloperoxidase : 9acto-b4v5s8Streptomyces sp. Mg1 Bromoperoxidase. Hormone-sensitive_lipase_like : 9acto-b4v070Streptomyces sp. Mg1 Alpha/beta hydrolase-3. Lipase_2 : 9acto-b4v4q5Streptomyces sp. Mg1 Lipase. NLS3-Tex30 : 9acto-b4v944Streptomyces sp. Mg1 Putative uncharacterized protein. Peptidase_S37 : 9acto-b4v9e5Streptomyces sp. Secreted tripeptidyl aminopeptidase, 9acto-b4vfi7Streptomyces sp. Mg1 Secreted tripeptidyl aminopeptidase. RsbQ-like : 9acto-b4uy24Streptomyces sp. Mg1 Hydrolase. Tiancimycin-TnmK-Tripeptidase-HIP : 9actn-a0a0g3ujm9Streptomyces sp. Mg1. Surfactin hydrolase
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: 9acto-b4v0r1 Colored MSA for HNLyase_Bact (raw)
MSNLMNAVDPAVTFVLVHGAGSNAYGWSPVAAELGLRGHRAVAVDLPGHG
PGAYFPLSYQAPQDLARLRTEPSPIAGTTLADCAAHVAAVVRRAHRGGPV
VLAGQSLGGVTLNAAADLVPELISHLVYVSAFCPAKRASMNELMATQEAA
ASHIFKMPPVPTPPELGVTRVNWRSSDSDFLRTVKEAIAADYSDSEVRTL
LNILEPDESAALGASDGRGLPHKWGRIPRTYVRFTEDRALPPALQDLMIR
EADETTPDNPFRVRSLAAPHIGPRDPALLADELEQVALLCR
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MSNLMNAVDPAVTFVLVHGAGSNAYGWSPVAAELGLRGHRAVAVDLPGHG PGAYFPLSYQAPQDLARLRTEPSPIAGTTLADCAAHVAAVVRRAHRGGPV VLAGQSLGGVTLNAAADLVPELISHLVYVSAFCPAKRASMNELMATQEAA ASHIFKMPPVPTPPELGVTRVNWRSSDSDFLRTVKEAIAADYSDSEVRTL LNILEPDESAALGASDGRGLPHKWGRIPRTYVRFTEDRALPPALQDLMIR EADETTPDNPFRVRSLAAPHIGPRDPALLADELEQVALLCR
|
|
|