Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9agam-x8iza2

Rhizoctonia solani feruloyl esterase B p-coumaroyl esterase (fae3 gene)

Comment
Other strains: Rhizoctonia solani AG-3 (Rhs1AP; 123E)


Relationship
Family|Tannase
Block| X
Position in NCBI Life Tree|Rhizoctonia solani AG-3 Rhs1AP
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetes incertae sedis: N E > Cantharellales: N E > Ceratobasidiaceae: N E > Rhizoctonia: N E > Rhizoctonia solani: N E > Rhizoctonia solani AG-3: N E > Rhizoctonia solani AG-3 Rhs1AP: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Chlorogenic-acid
No inhibitor
3 Genbank : EUC55453, LN877212, KEP51780
2 UniProt : X8IZA2, A0A074S2N5
2 UniProt : X8IZA2, A0A074S2N5
2 Interpro : X8IZA2, A0A074S2N5
2 Prodom : X8IZA2, A0A074S2N5
2 Pfam : X8IZA2, A0A074S2N5
2 PIRSF : X8IZA2, A0A074S2N5
2 SUPERFAM : X8IZA2, A0A074S2N5
Sequence
Graphical view for this peptide sequence: 9agam-x8iza2
Colored MSA for Tannase (raw)
MGCDRPRQVLHSLQEFTVMFSKWLPISAVLLYTSASAKALDCAGLFKKSQ
TLIKGIHPYVAGIHPANVTFVPVGNIAYPDPVPDLPEFCRFGAVYNTSPK
SKFRFEVWLPTSKKWNGRFAFIGNGGDAGGVNYADMAIPLAKYGFVVAST
NTGHDGTHGDGTFAISNPESQIDFGRRAVHLSTVFAKTIAKSYYGKPSTY
NYWIGCSSGGKQGLKSAQAYPADFDGVIAGAPAQWWPHLNGFTTHVNMLN
AKATTPGATIPTSFFTALNQEVVAQCGKLDGVDDGIITNASTSRFFSTTF
FDMSPINCLSKPQLVTLKAIYTNWTSSNGEFLFPTFEPGSEFGWPNTVNG
VPYGPGPDYFLYQVYNKTSVQKLQINEAELQRLVAIADVTNPGQSRAIDP
NLNPFFKRGGKLLQYHGFADPLIPSGSSLWYYEHVRSYFKNADLSDRYRL
FMIPGVAHCSGGPGADAFGRPGQRSVSLGGAGQSLSFTPQYDMILATINW
VEKGVAPKSLIGTKYKNNNIREGAKFTRLFCPYPQEAIYRGGNVNVASSY
SCGVRA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGCDRPRQVLHSLQEFTVMFSKWLPISAVLLYTSASAKALDCAGLFKKSQ
TLIKGIHPYVAGIHPANVTFVPVGNIAYPDPVPDLPEFCRFGAVYNTSPK
SKFRFEVWLPTSKKWNGRFAFIGNGGDAGGVNYADMAIPLAKYGFVVAST
NTGHDGTHGDGTFAISNPESQIDFGRRAVHLSTVFAKTIAKSYYGKPSTY
NYWIGCSSGGKQGLKSAQAYPADFDGVIAGAPAQWWPHLNGFTTHVNMLN
AKATTPGATIPTSFFTALNQEVVAQCGKLDGVDDGIITNASTSRFFSTTF
FDMSPINCLSKPQLVTLKAIYTNWTSSNGEFLFPTFEPGSEFGWPNTVNG
VPYGPGPDYFLYQVYNKTSVQKLQINEAELQRLVAIADVTNPGQSRAIDP
NLNPFFKRGGKLLQYHGFADPLIPSGSSLWYYEHVRSYFKNADLSDRYRL
FMIPGVAHCSGGPGADAFGRPGQRSVSLGGAGQSLSFTPQYDMILATINW
VEKGVAPKSLIGTKYKNNNIREGAKFTRLFCPYPQEAIYRGGNVNVASSY
SCGVRA


Reference
    Title: A p-coumaroyl esterase from Rhizoctonia solani with a pronounced chlorogenic acid esterase activity
    Nieter A, Kelle S, Linke D, Berger RG
    Ref: N Biotechnol, 37:153, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer