Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9baci-a0a060lz75

Bacillus lehensis G1. Uncharacterized protein

Relationship
Family|BlEst2-lipase-like
Block| X
Position in NCBI Life Tree|Bacillus lehensis G1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus lehensis: N E > Bacillus lehensis G1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP003923, WP_051667376
1 UniProt : A0A060LZ75
1 UniProt : A0A060LZ75
1 Interpro : A0A060LZ75
1 Prodom : A0A060LZ75
1 Pfam : A0A060LZ75
1 PIRSF : A0A060LZ75
1 SUPERFAM : A0A060LZ75
Sequence
Graphical view for this peptide sequence: 9baci-a0a060lz75
Colored MSA for BlEst2-lipase-like (raw)
MIKKISLIFLTVILVFFFMQPNLSYGFSKGKPDPSAPPGTWYIGDAPHVK
TGSPILFVHGLTGSGATWFEPNDMYRQARDAGHPAAFINLYPDQSYWDNG
QMLANKLAEMYNHFGEKMIVVGHSKGGVDIQTALLHYGAERYVSKVFTLG
TPHHGSQLANLAYSNWAGWLAGIIGMRSPGTDSLRTGTMAAFRNQTDRLV
GAHSVPFQTLSGRSWGSFGTSLYFGGVYLNSYGTNDGAVTVDSSRLSYAN
ELASLSLDHYAIAEGHRVFRYLQPRLANNEQMVETRQADYGTIIRGGELN
GTATQPFQLEDEIQTVTFSVLAHESLENVTFISPNGDEHPVEAIEKEHEQ
SIFAGAYSHFIELDQPESGTWTIEMNSTTAGGYFAVASIEGGLTSTLQLE
EDVVHAFDATPTDVTYSVHINDQLHVEDANLDALHTFHLPMKSNTSQNDN
HGLQRHNKGWNAV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIKKISLIFLTVILVFFFMQPNLSYGFSKGKPDPSAPPGTWYIGDAPHVK
TGSPILFVHGLTGSGATWFEPNDMYRQARDAGHPAAFINLYPDQSYWDNG
QMLANKLAEMYNHFGEKMIVVGHSKGGVDIQTALLHYGAERYVSKVFTLG
TPHHGSQLANLAYSNWAGWLAGIIGMRSPGTDSLRTGTMAAFRNQTDRLV
GAHSVPFQTLSGRSWGSFGTSLYFGGVYLNSYGTNDGAVTVDSSRLSYAN
ELASLSLDHYAIAEGHRVFRYLQPRLANNEQMVETRQADYGTIIRGGELN
GTATQPFQLEDEIQTVTFSVLAHESLENVTFISPNGDEHPVEAIEKEHEQ
SIFAGAYSHFIELDQPESGTWTIEMNSTTAGGYFAVASIEGGLTSTLQLE
EDVVHAFDATPTDVTYSVHINDQLHVEDANLDALHTFHLPMKSNTSQNDN
HGLQRHNKGWNAV


Reference
    Title: A comparative genomic analysis of the alkalitolerant soil bacterium Bacillus lehensis G1
    Noor YM, Samsulrizal NH, Jema'on NA, Low KO, Ramli AN, Alias NI, Damis SI, Fuzi SF, Isa MN and Illias RM <5 more author(s)>
    Ref: Gene, 545:253, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer