Gene_locus Report for: 9baci-q2ama7Bacillus weihenstephanensis KBAB4 phospholipase/carboxylesterase Comment previously LYsophospholipase_carboxylesterase Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus mycoides: N E > Bacillus mycoides KBAB4: N E
6_AlphaBeta_hydrolase : 9baci-q2ayy0Bacillus weihenstephanensis KBAB4 alpha/beta hydrolase fold. AlphaBeta_hydrolase : bacwk-A9VQH3Bacillus weihenstephanensis; Bacillus cereus) Bacillus anthracis; Bacillus sp. ; hypothetical protein, bacwk-A9VF75Bacillus weihenstephanensis KBAB4 ; Bacillus cereus ; alpha/beta hydrolase fold, 9baci-q2anp3Bacillus weihenstephanensis KBAB4 alpha/beta hydrolase fold, 9baci-q2anz5Bacillus weihenstephanensis KBAB4 alpha/beta superfamily hydrolase, 9baci-q2api0Bacillus weihenstephanensis KBAB4 alpha/beta hydrolase fold, 9baci-q2asa0Bacillus weihenstephanensis KBAB4 alpha/beta hydrolase fold, 9baci-q2asu9Bacillus weihenstephanensis KBAB4 alpha/beta hydrolase fold precursor, 9baci-q2atd7Bacillus weihenstephanensis KBAB4 alpha/beta hydrolase fold, 9baci-q2avy2Bacillus weihenstephanensis KBAB4 alpha/beta hydrolase fold. Duf_1100-S : 9baci-q2azx1Bacillus weihenstephanensis KBAB4 probable dipeptidyl aminopeptidase. LYsophospholipase_carboxylesterase : 9baci-q2am72Bacillus weihenstephanensis KBAB4 phospholipase/carboxylesterase. PC-sterol_acyltransferase : 9baci-q2aw21Bacillus weihenstephanensis KBAB4 hypothetical protein. Proline_iminopeptidase : bacwk-A9VF42Bacillus weihenstephanensis KBAB4; Bacillus cereus alpha/beta hydrolase. Thioesterase : 9baci-q2azg3Bacillus weihenstephanensis KBAB4 non-ribosomal peptide synthase:amino acid adenylation, bacwk-a9vqm8Bacillus weihenstephanensis, Bacillus cereus thioesterase. YcjY-like : 9baci-q2avg2Bacillus weihenstephanensis KBAB4 dienelactone hydrolase Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Bacillus mycoides: N, E.
Bacillus mycoides DSM 2048: N, E.
Bacillus mycoides Rock3-17: N, E.
Bacillus weihenstephanensis: N, E.
Bacillus mycoides Rock1-4: N, E.
Bacillus weihenstephanensis FSL R5-860: N, E.
Bacillus weihenstephanensis NBRC 101238 = DSM 11821: N, E.
Bacillus mycoides FSL H7-687: N, E.
Bacillus cereus HuA2-4: N, E.
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: 9baci-q2ama7 Colored MSA for 6_AlphaBeta_hydrolase (raw)
MENNMTYIKLLNETLHCYANKGSFEAYSYIMNNAKDVMGNEAQIYNFKYA
LASAAGLEEEALHLMKKAIIENGFWYGSEYLISDDDLKPLHKFEEFHRMV
QLCKEREELAKKSEQADVKYKYSKQTENLLITLHGDQENIQIIEPYWNSV
MEQGFMLALPQSSQIQFSDGYVWDNIERGREELKGHYNKIKVNKPFENII
IGGFSAGARVALHSMLQGEIEVNGFIFVAPWLPEMEEWEEMIGILHDKSI
KGYIICGDQDEDCFEGTQQFVKLLKDKNIEHKYKVVPNLNHDYPHNFDEL
LKEAIEYIGSKNN
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MENNMTYIKLLNETLHCYANKGSFEAYSYIMNNAKDVMGNEAQIYNFKYA LASAAGLEEEALHLMKKAIIENGFWYGSEYLISDDDLKPLHKFEEFHRMV QLCKEREELAKKSEQADVKYKYSKQTENLLITLHGDQENIQIIEPYWNSV MEQGFMLALPQSSQIQFSDGYVWDNIERGREELKGHYNKIKVNKPFENII IGGFSAGARVALHSMLQGEIEVNGFIFVAPWLPEMEEWEEMIGILHDKSI KGYIICGDQDEDCFEGTQQFVKLLKDKNIEHKYKVVPNLNHDYPHNFDEL LKEAIEYIGSKNN
|
|
|