Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-Est97

uncultured bacterium cold-adapted esterase from an Arctic intertidal metagenomic library

Relationship
Family|Bacterial_Est97
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 4AO6, 4AO7, 4AO8
No kinetic





No Substrate
No inhibitor
1 Genbank : JQ807992
1 UniProt : J7FSB6
3 Structure : 4AO6, 4AO7, 4AO8
1 UniProt : J7FSB6
1 Interpro : J7FSB6
1 Prodom : J7FSB6
1 Pfam : J7FSB6
1 PIRSF : J7FSB6
1 SUPERFAM : J7FSB6
Sequence
Graphical view for this peptide sequence: 9bact-Est97
Colored MSA for Bacterial_Est97 (raw)
MRHQMSWNGKDERLSVQERGFSLEVDGRTVPGVYWSPAEGSSDRLVLLGH
GGTTHKKVEYIEQVAKLLVGRGISAMAIDGPGHGERASVQAGREPTDVVG
LDAFPRMWHEGGGTAAVIADWAAALDFIEAEEGPRPTGWWGLSMGTMMGL
PVTASDKRIKVALLGLMGVEGVNGEDLVRLAPQVTCPVRYLLQWDDELVS
LQSGLELFGKLGTKQKTLHVNPGKHSAVPTWEMFAGTVDYLDQRLK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRHQMSWNGKDERLSVQERGFSLEVDGRTVPGVYWSPAEGSSDRLVLLGH
GGTTHKKVEYIEQVAKLLVGRGISAMAIDGPGHGERASVQAGREPTDVVG
LDAFPRMWHEGGGTAAVIADWAAALDFIEAEEGPRPTGWWGLSMGTMMGL
PVTASDKRIKVALLGLMGVEGVNGEDLVRLAPQVTCPVRYLLQWDDELVS
LQSGLELFGKLGTKQKTLHVNPGKHSAVPTWEMFAGTVDYLDQRLK


Reference
    Title: Functional and structural studies of a novel cold-adapted esterase from an Arctic intertidal metagenomic library
    Fu J, Leiros HK, de Pascale D, Johnson KA, Blencke HM, Landfald B
    Ref: Applied Microbiology & Biotechnology, 97:3965, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer