Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a097i5b4

uncultured bacterium. Carboxylic ester hydrolase

Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KM406413
1 UniProt : A0A097I5B4
1 UniProt : A0A097I5B4
1 Interpro : A0A097I5B4
1 Prodom : A0A097I5B4
1 Pfam : A0A097I5B4
1 PIRSF : A0A097I5B4
1 SUPERFAM : A0A097I5B4
Sequence
Graphical view for this peptide sequence: 9bact-a0a097i5b4
Colored MSA for Carb_B_Bacteria (raw)
MNARLLSRSRRLLAAVALLLGAGLVSPTAHAIFDRALVHTDKGWVRGEVT
PTMKKYLGIPYAAPPVGERRWRPPQPVKPWKGVRDATQFANHCPQPASPF
GLASTTEDCLYLNVYTPNHKGILRDLLHDHPVMVWIHGGALFLGESDDYN
PQKLVEREDVIVVTINYRLGFLGFLAHPALSAESSYGGSGNYGLMDQQAA
LEWVRRNIRRFGGDPNKVTIFGESAGGLSVHSQLASPLANKLFHRAIIQS
GAYAIQHPTLAQAEAAGQAAAVAFGCADQSAACLRAVPVETLLANQGSGG
FVPNVDGKVLPQTIRDALASGQFNQVPVMQGANHDEWRLFVALQHDLVGN
PVTPANYVDAIAALGIPTPTAAFLAANVYPLAAYPSPAIALGALGTDLVF
ACNARTSVRLLAAHVPTYAYEFNDANAPQPFLPPVSFPYGAYHAAEIQYV
LGIRPNLPPALVPPFTPDQQRLSDHMINYWGNFAKHGVPNGGGSPLWRRY
DPAADVVQSLLPPTPTTKADFAADHKCGFWAPGT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNARLLSRSRRLLAAVALLLGAGLVSPTAHAIFDRALVHTDKGWVRGEVT
PTMKKYLGIPYAAPPVGERRWRPPQPVKPWKGVRDATQFANHCPQPASPF
GLASTTEDCLYLNVYTPNHKGILRDLLHDHPVMVWIHGGALFLGESDDYN
PQKLVEREDVIVVTINYRLGFLGFLAHPALSAESSYGGSGNYGLMDQQAA
LEWVRRNIRRFGGDPNKVTIFGESAGGLSVHSQLASPLANKLFHRAIIQS
GAYAIQHPTLAQAEAAGQAAAVAFGCADQSAACLRAVPVETLLANQGSGG
FVPNVDGKVLPQTIRDALASGQFNQVPVMQGANHDEWRLFVALQHDLVGN
PVTPANYVDAIAALGIPTPTAAFLAANVYPLAAYPSPAIALGALGTDLVF
ACNARTSVRLLAAHVPTYAYEFNDANAPQPFLPPVSFPYGAYHAAEIQYV
LGIRPNLPPALVPPFTPDQQRLSDHMINYWGNFAKHGVPNGGGSPLWRRY
DPAADVVQSLLPPTPTTKADFAADHKCGFWAPGT


Reference
    Title: Structural and biochemical characterization of a metagenome-derived esterase with a long N-terminal extension
    Okano H, Hong X, Kanaya E, Angkawidjaja C, Kanaya S
    Ref: Protein Science, 24:93, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer