Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a178idt1

Opitutaceae bacterium TSB47. AXE1 domain-containing protein

Comment
only central part Pectin_methylesterase


Relationship
Family|Pectin_methylesterase
Block| X
Position in NCBI Life Tree|Opitutaceae bacterium TSB47
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Verrucomicrobia: N E > Opitutae: N E > Opitutales: N E > Opitutaceae: N E > unclassified Opitutaceae: N E > Opitutaceae bacterium TSB47: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : LRRQ01000143, WP_068771792.1
1 UniProt : A0A178IDT1
1 UniProt : A0A178IDT1
1 Interpro : A0A178IDT1
1 Pfam : A0A178IDT1
1 PIRSF : A0A178IDT1
1 SUPERFAM : A0A178IDT1
Sequence
Graphical view for this peptide sequence: 9bact-a0a178idt1
Colored MSA for Pectin_methylesterase (raw)
RAAWEKQARALRPALLAALRLSPMPDAPRAQPILTSERRMDGYRVQNFAI
ETLPGVFVCGSVYMPGRVAGKCPLVVSPNGHFPGGRYRDDQQIRCAMFAR
MGAWAVSYDLFAWGESLLQFDASAHRTPMAQTMQILNGIRIIDYFSKLPE
IDPDRIAVTGASGGGSQTMMLAAIDDRVGVSVPVVMVSAHFDGGCPCESG
QPIHLAAGGMNNVELAALAAPRPQLVVSDGGDWTAGVPDVEYPFLRHVYG
LYGKTEAVANVHFPREGHDYGPSKRKAVYSFLAAHLGMDLTAAQNAKGEI
DESACTVEP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RAAWEKQARALRPALLAALRLSPMPDAPRAQPILTSERRMDGYRVQNFAI
ETLPGVFVCGSVYMPGRVAGKCPLVVSPNGHFPGGRYRDDQQIRCAMFAR
MGAWAVSYDLFAWGESLLQFDASAHRTPMAQTMQILNGIRIIDYFSKLPE
IDPDRIAVTGASGGGSQTMMLAAIDDRVGVSVPVVMVSAHFDGGCPCESG
QPIHLAAGGMNNVELAALAAPRPQLVVSDGGDWTAGVPDVEYPFLRHVYG
LYGKTEAVANVHFPREGHDYGPSKRKAVYSFLAAHLGMDLTAAQNAKGEI
DESACTVEP



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer