Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a1i7phd9

Lacunisphaera limnophila. Alpha/beta hydrolase family protein

Relationship
Family|UCP031982
Block| X
Position in NCBI Life Tree|Lacunisphaera limnophila
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Verrucomicrobia: N E > Opitutae: N E > Opitutales: N E > Opitutaceae: N E > Lacunisphaera: N E > Lacunisphaera limnophila: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP016094, WP_069960413
1 UniProt : A0A1I7PHD9
1 UniProt : A0A1I7PHD9
1 Interpro : A0A1I7PHD9
1 Pfam : A0A1I7PHD9
1 PIRSF : A0A1I7PHD9
1 SUPERFAM : A0A1I7PHD9
Sequence
Graphical view for this peptide sequence: 9bact-a0a1i7phd9
Colored MSA for UCP031982 (raw)
MHSGFQHLPIPEPTSGGSFPAIVQYPTTQPAAGVSIGPFNWEATLDATPA
PGRFPVCLIAHGAGGSHLLYREIATHLARSGWIVVCPEAPRDNRNDNSLA
YTDEAVTNRCRQLSQTLDALLGHPTFGPAANPQRVGLVGHSLGGCAALAL
AGGQPWSRNRTPIPVQPDPRFQAAVLLAPATGYYRGPDALARVSGRFLVL
AGEKDDVTPAEAIRQDLRPLPAAAAGEFVVVRGAGHYSFLSPFPAMMRRP
DFPPGQDPDGFDRPQFHTELPGLIESFLSRSLPDA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHSGFQHLPIPEPTSGGSFPAIVQYPTTQPAAGVSIGPFNWEATLDATPA
PGRFPVCLIAHGAGGSHLLYREIATHLARSGWIVVCPEAPRDNRNDNSLA
YTDEAVTNRCRQLSQTLDALLGHPTFGPAANPQRVGLVGHSLGGCAALAL
AGGQPWSRNRTPIPVQPDPRFQAAVLLAPATGYYRGPDALARVSGRFLVL
AGEKDDVTPAEAIRQDLRPLPAAAAGEFVVVRGAGHYSFLSPFPAMMRRP
DFPPGQDPDGFDRPQFHTELPGLIESFLSRSLPDA



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer