Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a4q5nsn3

bacterium. Alpha/beta hydrolase

Relationship
Family|FaeC
Block| X
Position in NCBI Life Tree|Bacteria bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > unclassified Bacteria: N E > unclassified Bacteria (miscellaneous): N E > bacterium: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : SDZD01000021
1 UniProt : A0A4Q5NSN3
1 UniProt : A0A4Q5NSN3
1 Interpro : A0A4Q5NSN3
1 Prodom : A0A4Q5NSN3
1 Pfam : A0A4Q5NSN3
1 PIRSF : A0A4Q5NSN3
1 SUPERFAM : A0A4Q5NSN3
Sequence
Graphical view for this peptide sequence: 9bact-a0a4q5nsn3
Colored MSA for FaeC (raw)
SPGCGKELGDFKSGIHTMTSAGLERKYILDLPDNYDKNKPYRLIFTMHMM
GGSMQSIANDQFYRLKPYAQKNNIPCIFVAPQGYTDGSPWRMRDDKDHIF
FADMLALFKDKLSVDTSRIFCCGFSFGAMVTYSLSLEFQKDLRAVACYAP
ANWNIYLPPNKHEPIAFYSTTGTQDGICKWVNSDERREGGKYCVLTHLQD
NGLKEMPEIPIATTQTHITTEFKGLVPEYPVVFGSFVGGHMDNARDPGEE
ETWIAKESWDFFMRF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SPGCGKELGDFKSGIHTMTSAGLERKYILDLPDNYDKNKPYRLIFTMHMM
GGSMQSIANDQFYRLKPYAQKNNIPCIFVAPQGYTDGSPWRMRDDKDHIF
FADMLALFKDKLSVDTSRIFCCGFSFGAMVTYSLSLEFQKDLRAVACYAP
ANWNIYLPPNKHEPIAFYSTTGTQDGICKWVNSDERREGGKYCVLTHLQD
NGLKEMPEIPIATTQTHITTEFKGLVPEYPVVFGSFVGGHMDNARDPGEE
ETWIAKESWDFFMRF


Reference
    Title: Poplar phyllosphere harbors disparate isoprene-degrading bacteria
    Crombie AT, Larke-Mejia NL, Emery H, Dawson R, Pratscher J, Murphy GP, McGenity TJ, Murrell JC
    Ref: Proc Natl Acad Sci U S A, 115:13081, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer