Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-d4inh0

Alistipes shahii WAL 8301 AL1_RS10290 alpha/beta hydrolase

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Alistipes shahii WAL 8301
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Bacteroidia: N E > Bacteroidales: N E > Rikenellaceae: N E > Alistipes: N E > Alistipes shahii: N E > Alistipes shahii WAL 8301: N E


Molecular evidence
Database
No mutation
1 structure:
7DQ9: Novel esterase from gut Alistipes shahii with an alpha-helical cap domain shaping the substrate-binding pocket
No kinetic





No Substrate
No inhibitor
2 Genbank : WP_015547301, CBK64482
1 UniProt : D4INH0
1 Structure : 7DQ9
1 UniProt : D4INH0
1 Interpro : D4INH0
1 Prodom : D4INH0
1 Pfam : D4INH0
1 PIRSF : D4INH0
1 SUPERFAM : D4INH0
Sequence
Graphical view for this peptide sequence: 9bact-d4inh0
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MIEKFIMAGPTALHVCDSQKGDKCVVLLHGYLESMLVWEDFVPFLYKELR
VVTLDLPGHGISVVTGEEHSMEFLADTVADALRALGIPRCTLVGHSMGGY
VALAFCERHPDMLNGVVLLSSTPNADTPEKSENRRREIALVKAGKKDALA
RVAPEAGFAEDNRTRMKDYIEDLTEQVAVTEDEGIVALLNGMIARKDQNE
MLRASKVPQLFILGRKDNYIPVEAAEKMVKEHLQARVVWLENSGHMGFLE
EPETTARAILDFVNGK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIEKFIMAGPTALHVCDSQKGDKCVVLLHGYLESMLVWEDFVPFLYKELR
VVTLDLPGHGISVVTGEEHSMEFLADTVADALRALGIPRCTLVGHSMGGY
VALAFCERHPDMLNGVVLLSSTPNADTPEKSENRRREIALVKAGKKDALA
RVAPEAGFAEDNRTRMKDYIEDLTEQVAVTEDEGIVALLNGMIARKDQNE
MLRASKVPQLFILGRKDNYIPVEAAEKMVKEHLQARVVWLENSGHMGFLE
EPETTARAILDFVNGK


Reference
    Title: The alpha-Helical Cap Domain of a Novel Esterase from Gut Alistipes shahii Shaping the Substrate-Binding Pocket
    Wei X, Wang YL, Wen BT, Liu SJ, Wang L, Sun L, Gu TY, Li Z, Bao Y and Xin F <3 more author(s)>
    Ref: Journal of Agricultural and Food Chemistry, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer