Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-TanHcw

Herbaspirillum camelliae; Herbaspirillum sp. WT00C tannase Tan Hcw plasmid partitioning protein

Comment
Other strains: Herbaspirillum camelliae; Herbaspirillum sp. WT00C; Degrades epigallocatechin and epicatechin gallates


Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Herbaspirillum camelliae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Oxalobacteraceae: N E > Herbaspirillum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: Epicatechin-gallate, Epigallocatechin-gallate
No inhibitor
2 Genbank : WP_233149367, AKN68239
Sequence
Graphical view for this peptide sequence: 9burk-TanHcw
Colored MSA for Esterase_phb (raw)
MTIRLLSRLRPFHLLGPMPRLVRLYRRGRMACLLGLALGAAALSPAQAVD
LSLKTIRVGNLSRAYFSERTSVGEARPLIIALHASGSSGSLMARATGLTE
IAEAAGYMIVYPNGTGLAIDARTWNSGGCCGYAQMHKVDDVAFLRALVEK
LAKDGLADPQRVYLVGVSNGGMMAYRMAAEAPGLFKAVAVVSAVLDVSPE
TVKAPMPVLHIHGSEDPFIPFLGGIGKQEVSQLPRISVARTIETWVKANG
AEPRPAVTDIPDSANDGTTIRQYTYRSKTDPQSVVLYEVKGGGHAWPGAV
IPIVNGGKSSQNMDASRTVVDFFNAHGGGRSDEPADENLPPGAKPLPAAT
PAPAVAPTPPPSPTRPAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTIRLLSRLRPFHLLGPMPRLVRLYRRGRMACLLGLALGAAALSPAQAVD
LSLKTIRVGNLSRAYFSERTSVGEARPLIIALHASGSSGSLMARATGLTE
IAEAAGYMIVYPNGTGLAIDARTWNSGGCCGYAQMHKVDDVAFLRALVEK
LAKDGLADPQRVYLVGVSNGGMMAYRMAAEAPGLFKAVAVVSAVLDVSPE
TVKAPMPVLHIHGSEDPFIPFLGGIGKQEVSQLPRISVARTIETWVKANG
AEPRPAVTDIPDSANDGTTIRQYTYRSKTDPQSVVLYEVKGGGHAWPGAV
IPIVNGGKSSQNMDASRTVVDFFNAHGGGRSDEPADENLPPGAKPLPAAT
PAPAVAPTPPPSPTRPAR


Reference
    Title: Degradation of epigallocatechin and epicatechin gallates by a novel tannase Tan(Hcw) from Herbaspirillum camelliae
    Lei J, Zhang Y, Ni X, Yu X, Wang X
    Ref: Microb Cell Fact, 20:197, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer