Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-a0a031gxb6

Janthinobacterium lividum. Hydrolase-like protein 2, exosortase system type 1 associated

Relationship
Family|Hydrolase-2_PEP
Block| X
Position in NCBI Life Tree|Janthinobacterium lividum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Oxalobacteraceae: N E > Janthinobacterium: N E > Janthinobacterium lividum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : JFYR01000002
1 UniProt : A0A031GXB6
1 UniProt : A0A031GXB6
1 Interpro : A0A031GXB6
1 Prodom : A0A031GXB6
1 Pfam : A0A031GXB6
1 PIRSF : A0A031GXB6
1 SUPERFAM : A0A031GXB6
Sequence
Graphical view for this peptide sequence: 9burk-a0a031gxb6
Colored MSA for Hydrolase-2_PEP (raw)
MNRALTDALPLLPFFLPASGGQRYCLLHLPPPGQAARGGILYVHPFAEEL
NKSRHVAAAQARAFAAAGYSVLQIDLFGCGDSSGDFGEARWNIWHNDLHL
ACAWLAQRVDGPLTVWGLRLGALLALDFASNPPLPLARLLLWQPELDGRR
VIDRFLRLRLAAGMLAGGGQEAPGHARAALAESEPVEVAGYLLAPELAHA
IDDVSASALQPAVPVYWLDYRGPDQAAAPLPPLARQWRDQGAAVHVASFG
DGPFWHSGELLACPQLLDATRALCRDWLDEERTPS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNRALTDALPLLPFFLPASGGQRYCLLHLPPPGQAARGGILYVHPFAEEL
NKSRHVAAAQARAFAAAGYSVLQIDLFGCGDSSGDFGEARWNIWHNDLHL
ACAWLAQRVDGPLTVWGLRLGALLALDFASNPPLPLARLLLWQPELDGRR
VIDRFLRLRLAAGMLAGGGQEAPGHARAALAESEPVEVAGYLLAPELAHA
IDDVSASALQPAVPVYWLDYRGPDQAAAPLPPLARQWRDQGAAVHVASFG
DGPFWHSGELLACPQLLDATRALCRDWLDEERTPS



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer