Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-a0a0q6tdv0

Pelomonas sp. Root1217. Uncharacterized protein

Relationship
Family|UCP031982
Block| X
Position in NCBI Life Tree|Pelomonas sp. Root1217
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Pelomonas: N E > Pelomonas sp. Root1217: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : LMDC01000029, WP_057300759
1 UniProt : A0A0Q6TDV0
1 UniProt : A0A0Q6TDV0
1 Interpro : A0A0Q6TDV0
1 Pfam : A0A0Q6TDV0
1 PIRSF : A0A0Q6TDV0
1 SUPERFAM : A0A0Q6TDV0
Sequence
Graphical view for this peptide sequence: 9burk-a0a0q6tdv0
Colored MSA for UCP031982 (raw)
PGADALTGQQLPLLLYVLYPTRADNARPNYAFPYKDTGDNVFPHMQAPGE
RPVFADAAARYPLIVYSGGYNTHGLWHLAHLKQLASHGYIVVDIFHGDGR
VSGYAETVALRRVAFKAALDHVLSHPDFAGAVDTARIGASGASAGGQTVL
AMLGGADPAVPGRSFRDARLKAGFGLVPFLGASFGIWPFQTHAWSFGRDF
SGLAQVKNPFFAVYAEKDGSVSPDSVKAGVRRLGGPAWAVEMPGEGH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

PGADALTGQQLPLLLYVLYPTRADNARPNYAFPYKDTGDNVFPHMQAPGE
RPVFADAAARYPLIVYSGGYNTHGLWHLAHLKQLASHGYIVVDIFHGDGR
VSGYAETVALRRVAFKAALDHVLSHPDFAGAVDTARIGASGASAGGQTVL
AMLGGADPAVPGRSFRDARLKAGFGLVPFLGASFGIWPFQTHAWSFGRDF
SGLAQVKNPFFAVYAEKDGSVSPDSVKAGVRRLGGPAWAVEMPGEGH



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer