Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9firm-c0bfi5

Coprococcus comes ATCC 27758 Putative uncharacterized protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Coprococcus comes ATCC 27758
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Clostridiales: N E > Lachnospiraceae: N E > Coprococcus: N E > Coprococcus comes: N E > Coprococcus comes ATCC 27758: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ABVR01000046
1 UniProt : C0BFI5
1 UniProt : C0BFI5
1 Interpro : C0BFI5
1 Pfam : C0BFI5
1 PIRSF : C0BFI5
1 SUPERFAM : C0BFI5
Sequence
Graphical view for this peptide sequence: 9firm-c0bfi5
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MVYLSISRKVKNYTKQILFASMILLNRGKNDSEKGQLTMKNKLKSCAILA
TLGAITIHLINKTLIEMATKDSLLNSSEGNYYDWRFGKIYYRKQGNGKPL
LLLHDLDAESSGVEWKKVAAILAEKHTVYTVDLLGCGRSEKPNITYTNFL
YVQMLTDFIKHVIGEKADVVATGESAAIAVMACGNDENVIGKICMVNPLS
LTELAKCPNKRTKTLKFLIEIPIIGTLLYNIIHSREAIDEKFVDKYLYDE
DTIDYQMTKIYHESAHNENAHSKYLFASIKGGYTKTNIYHCIRKATNSIC
IISGQYDENSIEIAKQYQKHVPAIECMCIKDTRHLPQIEQPEGFAEQLDI
LFSAE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVYLSISRKVKNYTKQILFASMILLNRGKNDSEKGQLTMKNKLKSCAILA
TLGAITIHLINKTLIEMATKDSLLNSSEGNYYDWRFGKIYYRKQGNGKPL
LLLHDLDAESSGVEWKKVAAILAEKHTVYTVDLLGCGRSEKPNITYTNFL
YVQMLTDFIKHVIGEKADVVATGESAAIAVMACGNDENVIGKICMVNPLS
LTELAKCPNKRTKTLKFLIEIPIIGTLLYNIIHSREAIDEKFVDKYLYDE
DTIDYQMTKIYHESAHNENAHSKYLFASIKGGYTKTNIYHCIRKATNSIC
IISGQYDENSIEIAKQYQKHVPAIECMCIKDTRHLPQIEQPEGFAEQLDI
LFSAE



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer