Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-q1n3e3

Oceanobacter sp. RED65 hydrolase, alpha/beta fold family protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Oceanobacter sp. RED65
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Oceanospirillales: N E > Oceanospirillaceae: N E > Bermanella: N E > Bermanella marisrubri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AAQH01000005
1 UniProt : Q1N3E3
1 UniProt : Q1N3E3
1 Interpro : Q1N3E3
1 Pfam : Q1N3E3
1 PIRSF : Q1N3E3
1 SUPERFAM : Q1N3E3
Sequence
Graphical view for this peptide sequence: 9gamm-q1n3e3
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MPYFQHHNVNFHYVEECSQEKSKGTVIALHGLAQNTHYWTDTGITESLAK
DYHVVCLDMRGHGLTTVDGEPKGYDVEVLIEDVNALANHLDIDRFHLMGH
STGGMVAARYAMHYGQGANQRLRSLLLCNTSASIMFSKMPKFANEAAIKA
MAYSFEHFSWQQIIQGLKLQPGPLFKGLANHKDPKAMFDAAYEMMKHGDQ
NSIADFVRVFYNDPDHHESALRTIECPTLVVTAELDPIFTKTSEYFINNI
PNVEHAHAKHIGHMTALEDPIWFNSVISKFLRQHHDK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPYFQHHNVNFHYVEECSQEKSKGTVIALHGLAQNTHYWTDTGITESLAK
DYHVVCLDMRGHGLTTVDGEPKGYDVEVLIEDVNALANHLDIDRFHLMGH
STGGMVAARYAMHYGQGANQRLRSLLLCNTSASIMFSKMPKFANEAAIKA
MAYSFEHFSWQQIIQGLKLQPGPLFKGLANHKDPKAMFDAAYEMMKHGDQ
NSIADFVRVFYNDPDHHESALRTIECPTLVVTAELDPIFTKTSEYFINNI
PNVEHAHAKHIGHMTALEDPIWFNSVISKFLRQHHDK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer