Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-u7i252

Alcanivorax sp.; Alcanivorax dieselolei; Alcanivorax xenomutans, Carboxylesterase

Comment
Other strains: Alcanivorax sp. (PN-3; KX64203); Alcanivorax dieselolei; Alcanivorax xenomutans


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Alcanivorax sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Oceanospirillales: N E > Alcanivoracaceae: N E > Alcanivorax: N E > Alcanivorax sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AXBX01000015, WP_055099967.1, WP_063140040
1 UniProt : A0A154C554
1 Interpro : A0A154C554
1 Pfam : A0A154C554
1 PIRSF : A0A154C554
1 SUPERFAM : A0A154C554
Sequence
Graphical view for this peptide sequence: 9gamm-u7i252
Colored MSA for Carb_B_Bacteria (raw)
MANEQTVTLSQGRYQGVPGEGVHEFRGVPYALPPLGERRFKAPQPLPDSD
QVQRADRYPLPSLQRRNPLMGVEESGEDCLYLNIWVPEGEGPFPVMLWYH
GGGYTAGSVSQMLYNGAELARNGKVVVVNAAYRLGAHGFADFASVLPEAD
SNLGLRDQIAALEWVNRHIEAFGGRADQVTIFGESAGGFSVASLMAAPRA
RPLFQRAIIQSGGADFVLSPEESRRVTEAFLAALPGEGDVAHRLRQADGE
AWLSAQGEALRTSVARGLRDSTPQFGMNFLPMVDGDLLPRVPVQAMADGA
CADIELLAGVCRDEWNFFQYSGPLAGFPTVEQMRAMDDAEILRRFERAAP
GNGQRLFDYYRAHVTPHPQRSNMDWFSAMESDRLFRVPTLRLLDAQAARQ
PRTWGFQFTWPSTQFGIPMGACHVVDVPFVFGITDTPVGQYFTGGGEQPK
QLARRVQQVWSDFAHGRGADWAAWSESRRVHQFGPGDSETELLDQEGEAL
WERVIPRPETAK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MANEQTVTLSQGRYQGVPGEGVHEFRGVPYALPPLGERRFKAPQPLPDSD
QVQRADRYPLPSLQRRNPLMGVEESGEDCLYLNIWVPEGEGPFPVMLWYH
GGGYTAGSVSQMLYNGAELARNGKVVVVNAAYRLGAHGFADFASVLPEAD
SNLGLRDQIAALEWVNRHIEAFGGRADQVTIFGESAGGFSVASLMAAPRA
RPLFQRAIIQSGGADFVLSPEESRRVTEAFLAALPGEGDVAHRLRQADGE
AWLSAQGEALRTSVARGLRDSTPQFGMNFLPMVDGDLLPRVPVQAMADGA
CADIELLAGVCRDEWNFFQYSGPLAGFPTVEQMRAMDDAEILRRFERAAP
GNGQRLFDYYRAHVTPHPQRSNMDWFSAMESDRLFRVPTLRLLDAQAARQ
PRTWGFQFTWPSTQFGIPMGACHVVDVPFVFGITDTPVGQYFTGGGEQPK
QLARRVQQVWSDFAHGRGADWAAWSESRRVHQFGPGDSETELLDQEGEAL
WERVIPRPETAK


Reference
    Title: Draft genome sequences for oil-degrading bacterial strains from beach sands impacted by the deepwater horizon oil spill
    Overholt WA, Green SJ, Marks KP, Venkatraman R, Prakash O, Kostka JE
    Ref: Genome Announc, 1:, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer