Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9myco-h1jyl6

Mycobacterium tusciae JS617 Putative uncharacterized protein

Relationship
Family|Est9X
Block| H
Position in NCBI Life Tree|Mycobacterium tusciae JS617
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tusciae: N E > Mycobacterium tusciae JS617: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9myco-h1jyl6
Colored MSA for Est9X (raw)
MGANRFAGQGSSGARFFAGLATMISLAIAACWSGDRGVPAPVVTTEVAVH
RISYSTRGPGDPTQNWGDFYLPAGPQAPDSIPLVVLIHGGSWKSRLDAAT
MTPYAQDLAKRGMAVFNIEYRRVGSGGGWPTTFQDVADALDYVSELNKLF
PQITTDDELVVGHSAGAQLAAWAGTRNGLTDNEVGNKPLFRPLRVIALAG
PLDMVHAANSGDNQVVTVLGGTPQQVPDRYQSVDPIQNIDPTMPVIAVHG
DADRTVPMALSQRYINEVERQHGVGEIIIASGENHLSIVSPTSPVYPRIL
DIITDVSTKTLEELEVDFRGGG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGANRFAGQGSSGARFFAGLATMISLAIAACWSGDRGVPAPVVTTEVAVH
RISYSTRGPGDPTQNWGDFYLPAGPQAPDSIPLVVLIHGGSWKSRLDAAT
MTPYAQDLAKRGMAVFNIEYRRVGSGGGWPTTFQDVADALDYVSELNKLF
PQITTDDELVVGHSAGAQLAAWAGTRNGLTDNEVGNKPLFRPLRVIALAG
PLDMVHAANSGDNQVVTVLGGTPQQVPDRYQSVDPIQNIDPTMPVIAVHG
DADRTVPMALSQRYINEVERQHGVGEIIIASGENHLSIVSPTSPVYPRIL
DIITDVSTKTLEELEVDFRGGG



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer