Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9vibr-a8jy01

Vibrio sp. GMD509 Vlip509

Relationship
Family|UCP031982
Block| X
Position in NCBI Life Tree|Vibrio sp. GMD509
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Vibrio: N E > Vibrio sp. GMD509: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : EF535529
1 UniProt : A8JY01
1 UniProt : A8JY01
1 Interpro : A8JY01
1 Prodom : A8JY01
1 Pfam : A8JY01
1 PIRSF : A8JY01
1 SUPERFAM : A8JY01
Sequence
Graphical view for this peptide sequence: 9vibr-a8jy01
Colored MSA for UCP031982 (raw)
MNWTHLLFIPLLLLCNSAVAFDVGFTQVTLTDNPNRPLNAAIWYPTSDKS
DTTLIGDNPAFIGTQVIKDAQIQSGTFPVILLSHGYRGNWRNQNWLATKL
ASRGYIVAAADHPGTTSFDQSPEQAEKWWERPRDVSRMLDYLLSETSWKQ
SANAENVTAIGHSLGGWTVMQLAGAKIDRATFKSECKQYNNPRTCGLTEE
LGLSKVQATEPNNKDLSDPRVQRAVSLDLGLARSFSVGSLNGITVPTLIL
AAGIDIGDLPQALESGYIAEHMPLSSRRYKVYENATHFSFIQGCKPGAIA
MLEEEVPGDGIICKDGLGASRGKLHQLILNDIVDFLNR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNWTHLLFIPLLLLCNSAVAFDVGFTQVTLTDNPNRPLNAAIWYPTSDKS
DTTLIGDNPAFIGTQVIKDAQIQSGTFPVILLSHGYRGNWRNQNWLATKL
ASRGYIVAAADHPGTTSFDQSPEQAEKWWERPRDVSRMLDYLLSETSWKQ
SANAENVTAIGHSLGGWTVMQLAGAKIDRATFKSECKQYNNPRTCGLTEE
LGLSKVQATEPNNKDLSDPRVQRAVSLDLGLARSFSVGSLNGITVPTLIL
AAGIDIGDLPQALESGYIAEHMPLSSRRYKVYENATHFSFIQGCKPGAIA
MLEEEVPGDGIICKDGLGASRGKLHQLILNDIVDFLNR


Reference
    Title: A new esterase showing similarity to putative dienelactone hydrolase from a strict marine bacterium, Vibrio sp. GMD509
    Park SY, Kim JT, Kang SG, Woo JH, Lee JH, Choi HT, Kim SJ
    Ref: Applied Microbiology & Biotechnology, 77:107, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer