Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aciac-a1tub9

Acidovorax avenae subsp. citrulli (strain AAC00-1) alpha/beta hydrolase fold

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Acidovorax avenae subsp. citrulli
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Acidovorax: N E > Acidovorax citrulli: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000512
1 UniProt : A1TUB9
1 UniProt : A1TUB9
1 Interpro : A1TUB9
1 Prodom : A1TUB9
1 Pfam : A1TUB9
1 PIRSF : A1TUB9
1 SUPERFAM : A1TUB9
Sequence
Graphical view for this peptide sequence: aciac-a1tub9
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MPMDPPRHAVSHRLRIDGLSLHCIEYPGDGPPLVLLHSLTGNARIFDGLI
LAGLADHFRVLVPEMCGRGQSETAFTQLSLADGLRHLLAWLDHFGIGSAA
LCGHSFGGLAALYATDRAPARVSHLALLDAAADMHPAAPALAAMAAIRLD
GLYPSVQAYRDAVVRPASFSQPWHAAMQGFVEADLAPVAPGIYTTAARSG
TAHIASLHVQSMAQREWRDCAARVQVPALLAQAAEPFWMGIPMLTDDGAG
TTARLLRAPRVRIPGNHFTMLYGAGAERIVQALAPWSGQGTAEPAAAMTV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPMDPPRHAVSHRLRIDGLSLHCIEYPGDGPPLVLLHSLTGNARIFDGLI
LAGLADHFRVLVPEMCGRGQSETAFTQLSLADGLRHLLAWLDHFGIGSAA
LCGHSFGGLAALYATDRAPARVSHLALLDAAADMHPAAPALAAMAAIRLD
GLYPSVQAYRDAVVRPASFSQPWHAAMQGFVEADLAPVAPGIYTTAARSG
TAHIASLHVQSMAQREWRDCAARVQVPALLAQAAEPFWMGIPMLTDDGAG
TTARLLRAPRVRIPGNHFTMLYGAGAERIVQALAPWSGQGTAEPAAAMTV



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer