Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acisd-d8je00

Acinetobacter sp. (strain JCM 1667 / KCTC 23045 / DR1) Putative hydrolase

Relationship
Family|UCP037442
Block| X
Position in NCBI Life Tree|Acinetobacter sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002080
1 UniProt : D8JE00
1 UniProt : D8JE00
1 Interpro : D8JE00
1 Pfam : D8JE00
1 PIRSF : D8JE00
1 SUPERFAM : D8JE00
Sequence
Graphical view for this peptide sequence: acisd-d8je00
Colored MSA for UCP037442 (raw)
MQSATQINEQLSQTVQFPALDGYQLKGTRYFATTPAKANIVVAGATGVPH
EFYRRFAEYMMQFGYQIFTFDYRGVGKSSPKSLKGFDMSYLDWGKLDLAG
AIEYLSKEPLPLFMVGHSYGGHALGLLPNHDKLLACYTFGTGAGWHGYMP
LKERFKVQVVWNIVFPPIVAVTGYLPWSKFNMGSDLPLNVYKQWRKWCKN
PKYFFADPEQQHLIEQYAAVKVPIYAVSALDDDWALPASCRAFMQHYRQA
QVSYVSLQPQDVAMKTIGHMGYFKKDAEHIWNKIRTTFDGFL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQSATQINEQLSQTVQFPALDGYQLKGTRYFATTPAKANIVVAGATGVPH
EFYRRFAEYMMQFGYQIFTFDYRGVGKSSPKSLKGFDMSYLDWGKLDLAG
AIEYLSKEPLPLFMVGHSYGGHALGLLPNHDKLLACYTFGTGAGWHGYMP
LKERFKVQVVWNIVFPPIVAVTGYLPWSKFNMGSDLPLNVYKQWRKWCKN
PKYFFADPEQQHLIEQYAAVKVPIYAVSALDDDWALPASCRAFMQHYRQA
QVSYVSLQPQDVAMKTIGHMGYFKKDAEHIWNKIRTTFDGFL


Reference
    Title: Complete genome sequence of the diesel-degrading Acinetobacter sp. strain DR1
    Jung J, Baek JH, Park W
    Ref: Journal of Bacteriology, 192:4794, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer