Gene_locus Report for: anapl-r0jlr8Anas platyrhynchos (Mallard) (Anas boschas). Arylacetamide deacetylase Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Galloanserae: N E > Anseriformes: N E > Anatidae: N E > Anas: N E > Anas platyrhynchos: N E
ABHD10 : anapl-u3i5h5Anas platyrhynchos (Mallard) (Anas boschas). Abhydrolase domain containing 10. ABHD13-BEM46 : anapl-r0lhc4Anas platyrhynchos (Mallard) (Anas boschas); Anas platyrhynchos platyrhynchos (Northern mallard). Abhydrolase domain-containing protein 13. Arb2_FAM172A : anapl-r0m1y3Anas platyrhynchos (Mallard) (Anas boschas). UPF0528 protein FAM172A. Arylacetamide_deacetylase : anapl-u3ivv9Anas platyrhynchos (Mallard) (Anas boschas). Uncharacterized protein, anapl-u3j4g1Anas platyrhynchos (Mallard) (Anas boschas). Uncharacterized protein, anapl-u3j4i2Anas platyrhynchos (Mallard) (Anas boschas). Uncharacterized protein, anapl-u3j4v5Anas platyrhynchos (Mallard) (Anas boschas). Uncharacterized protein. BCHE : anapl-BCHEAnas platyrhynchos (Domestic duck) (Anas boschas) butyrylcholinesterase. Carb_B_Chordata : anapl-r0jv14Anas platyrhynchos (Domestic duck) (Anas boschas) Carboxylesterase 7, anapl-thioeAnas platyrhynchos (Domestic duck) (Anas boschas) Fatty acyl-CoA hydrolase, medium chain thioesterase B. Cholesterol_esterase : anapl-r0lw36Anas platyrhynchos (Domestic duck) (Anas boschas) Bile salt-activated lipase. CMBL : anapl-r0ktn0Anas platyrhynchos (Mallard) (Anas boschas); Anas platyrhynchos platyrhynchos (Northern mallard). Carboxymethylenebutenolidase-like protein, anapl-r0l8l1Anas platyrhynchos (Mallard) (Anas boschas); Anas platyrhynchos platyrhynchos (Northern mallard). Carboxymethylenebutenolidase-like protein. Hepatic_Lipase : anapl-r0kv25Anas platyrhynchos (Mallard) (Anas boschas). Hepatic triacylglycerol lipase. Lipoprotein_Lipase : anapl-b6dzk9Anas platyrhynchos (Mallard) (Anas boschas); Cairina moschata (Muscovy duck). Lipoprotein lipase, anapl-u3imp7Anas platyrhynchos (Mallard) (Anas boschas). Lipase G, endothelial type. Maspardin-ACP33-SPG21_like : anapl-u3j4v8Anas platyrhynchos (Domestic duck) (Anas boschas). Uncharacterized protein. Monoglyceridelipase_lysophospholip : anapl-u3icy5Anas platyrhynchos (Mallard) (Anas boschas). Uncharacterized protein. Neuroligin : anapl-r0ljt0Anas platyrhynchos (Domestic duck) (Anas boschas) Neuroligin-4, X-linked, anapl-u3iqr9Anas platyrhynchos (Domestic duck) (Anas boschas) Uncharacterized protein. NLS3-Tex30 : anapl-r0k518Anas platyrhynchos (Domestic duck) (Anas boschas) Uncharacterized protein C13orf27-like protein, anapl-r0l4n7Anas platyrhynchos (Domestic duck) (Anas boschas) Uncharacterized protein KIAA1310. Pancreatic_lipase : anapl-r0lgx7Anas platyrhynchos (Mallard) (Anas boschas). Pancreatic triacylglycerol lipase, anapl-u3ild2Anas platyrhynchos (Mallard) (Anas boschas). Pancreatic lipase, anapl-u3imh5Anas platyrhynchos (Mallard) (Anas boschas). Pancreatic lipase. PC-sterol_acyltransferase : anapl-lcatAnas platyrhynchos (Domestic duck) lecithin cholesterol acyltransferase. Phospholipase : anapl-r0lin6Anas platyrhynchos (Mallard) (Anas boschas); Anas platyrhynchos platyrhynchos (Northern mallard). Lipase member H, anapl-r0jhf3Anas platyrhynchos (Mallard) (Anas boschas); Anas platyrhynchos platyrhynchos (Northern mallard). Lipase member H. SERHL : anapl-u3id17Anas platyrhynchos (Mallard) (Anas boschas). Serine hydrolase like 2. Thioesterase : anapl-sastAnas platyrhynchos (Domestic duck) (thioesterase II). Thyroglobulin : anapl-r0m5n4Anas platyrhynchos (Domestic duck) (Anas boschas) Thyroglobulin Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Anas platyrhynchos platyrhynchos: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: anapl-r0jlr8
Colored MSA for Arylacetamide_deacetylase (raw)
NMGAKLLCFCLASALVSYYIYTPIPENIEEGWKVMLVTSLFRTVGHAAEV
ADRLGMMHYMEVMRLITVAEHVAPTSDDNVTVTDTEFSNVAVRLYLPRKP
ARGLRRAVIYFHGGGWCVGQAGMKSYDLLSRWTSSQLDAVVVSVDYRLAP
KYHFPVQFEDVYSVTKFFLQSSVLSQYGVDPNRVCVAGDSAGGNLAAAVV
QKLLEDSEVTTRLKAHVLLYPALQTLDLNLPSYQQNENGLILPKSLMVRF
WSEYFTSDSSLREAMTSNSHVPAESGHLFQFVNWSNLLPEEMKKDYVYTS
PVFGSSELAKKYPGFLDPRAAPLLAEDARLRGLPPTYVLTCEYDVLRDDG
VMYVSRLRAAGVRVTHDHAKDAFHGALMFVSSPANLPVGNRLRNRYIAWL
NENL
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
NMGAKLLCFCLASALVSYYIYTPIPENIEEGWKVMLVTSLFRTVGHAAEV
ADRLGMMHYMEVMRLITVAEHVAPTSDDNVTVTDTEFSNVAVRLYLPRKP
ARGLRRAVIYFHGGGWCVGQAGMKSYDLLSRWTSSQLDAVVVSVDYRLAP
KYHFPVQFEDVYSVTKFFLQSSVLSQYGVDPNRVCVAGDSAGGNLAAAVV
QKLLEDSEVTTRLKAHVLLYPALQTLDLNLPSYQQNENGLILPKSLMVRF
WSEYFTSDSSLREAMTSNSHVPAESGHLFQFVNWSNLLPEEMKKDYVYTS
PVFGSSELAKKYPGFLDPRAAPLLAEDARLRGLPPTYVLTCEYDVLRDDG
VMYVSRLRAAGVRVTHDHAKDAFHGALMFVSSPANLPVGNRLRNRYIAWL
NENL
|
|
|
|
