Gene_locus Report for: apime-a0a088a591Apis mellifera (Honeybee). Hydrolase_4 domain-containing protein Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Hymenoptera: N E > Apocrita: N E > Aculeata: N E > Apoidea: N E > Apidae: N E > Apinae: N E > Apini: N E > Apis: N E > Apis mellifera: N E
ABHD11-Acetyl_transferase : apime-a0a088anj8Apis mellifera (Honeybee); Apis cerana cerana (Oriental honeybee). AB hydrolase-1 domain-containing protein. ABHD12-PHARC : apime-a0a088aj98Apis mellifera (Honeybee); Apis cerana. Uncharacterized protein. ACHE : apime-ACHEApis mellifera (honeybee); Apis cerana (Indian honeybee); Apis cerana cerana (Oriental honeybee) acetylcholinesterase 2 (ACHE) GB14873, apime-ACHE1Apis mellifera (Honeybee); Apis cerana (Indian honeybee) similar to acetylcholinesterase (LOC410270). Carboxypeptidase_S10 : apime-vcpApis mellifera (Honeybee) Venom serine carboxypeptidase. Carb_B_Arthropoda : apime-b2d0j5Apis mellifera (Honeybee) Venom carboxylesterase-6, apime-b7sw92Apis mellifera (Honeybee) Carboxylesterase, apime-estQ76LA5Apis mellifera (Honeybee) esterase, apime-h9knq2Apis mellifera (Honeybee) Uncharacterized protein, apime-a0a087zrw4Apis mellifera (Honeybee). Uncharacterized protein, apime-a0a088akg2Apis mellifera (Honeybee). Uncharacterized protein, apime-a0a088aq81Apis mellifera (Honeybee). Uncharacterized protein, apime-a0a088a5d8Apis mellifera (Honeybee). Uncharacterized protein, apime-a0a088a5d7Apis mellifera (Honeybee). Uncharacterized protein, apime-a0a088aw01Apis mellifera (Honeybee). Uncharacterized protein, apime-a0a088a7h8Apis mellifera (Honeybee). Uncharacterized protein, apime-a0a087zxf6Apis mellifera (Honeybee). Uncharacterized protein, apime-a0a088a9c4Apis mellifera (Honeybee). Uncharacterized protein. DPP4N_Peptidase_S9 : apime-vdpp4Apis mellifera (Honeybee) Venom dipeptidyl peptidase IV. Gliotactin : apime-h9k5b0Apis mellifera (Honeybee) Uncharacterized protein, apime-a0a088a211Apis mellifera (Honeybee). COesterase domain-containing protein. Kynurenine-formamidase : apime-a0a088a2a3Apis mellifera (Honeybee), Kynurenine formamidase, KFA, KFase, Arylformamidase, N-formylkynurenine formamidase, FKF. Maspardin-ACP33-SPG21_like : apime-h9kpm9Apis mellifera (Honeybee) Uncharacterized protein. Ndr_family : apime-h9kn60Apis mellifera (Honeybee); Apis cerana cerana; Apis cerana; (Oriental honeybee, Indian honeybee) Uncharacterized protein. Neuroligin : apime-b9vmq4Apis mellifera (Honeybee) Non-catalytic, apime-b9vmq5Apis mellifera (Honeybee) Non-catalytic, apime-b9vmq6Apis mellifera (Honeybee) Non-catalytic, apime-b9vmq7Apis mellifera (Honeybee) Non-catalytic, apime-a0a088atg1Apis mellifera (Honeybee). Uncharacterized protein. Neurotactin : apime-h9ks30Apis mellifera (Honeybee) Uncharacterized protein. NLS3-Tex30 : apime-h9k7q9Apis mellifera (Honeybee) Uncharacterized protein. OtherNon-catalytic_C : apime-h9ken5Apis mellifera (Honeybee) Uncharacterized protein, apime-h9kpe5Apis mellifera (Honeybee), Apis cerana (Indian honeybee) Uncharacterized protein. Pectinacetylesterase-Notum : apime-a0a088at80Apis mellifera (Honeybee). Uncharacterized protein. Valacyclovir-hydrolase : apime-h9k1r0Apis mellifera (Honeybee) Uncharacterized protein
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: apime-a0a088a591
Colored MSA for ABHD13-BEM46 (raw)
MSFCMRLARSKPIRLLGGIAMKCWAFSGTYILACFLLYWLYGGFSAFFLL
CFATTGILYHREDQLVYRPESPANSRVYVPAPSIFNLPYQSIYTRSGDGT
MLHMFFISQPEDRVKKVPTLLFLHGNAGNVGHRLKNAVGLYHTIQCNILM
LEYRGYGLSQGSPSEEGLYMDARAGIDYLSSRTDINTNEIIVFGRSLGGA
VAINLATEPENSQRIWCLILENTFTSIPDMAALLFGLKCLQYLPLFLYKN
KYLSILKVRSVTVPTLFISGLADTLVPPYMMQDLYKNCKSPCKKILSISG
GTHNETWCQPRYYKNICNFLNELRENPPIPVTSSHWQIDDI
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MSFCMRLARSKPIRLLGGIAMKCWAFSGTYILACFLLYWLYGGFSAFFLL
CFATTGILYHREDQLVYRPESPANSRVYVPAPSIFNLPYQSIYTRSGDGT
MLHMFFISQPEDRVKKVPTLLFLHGNAGNVGHRLKNAVGLYHTIQCNILM
LEYRGYGLSQGSPSEEGLYMDARAGIDYLSSRTDINTNEIIVFGRSLGGA
VAINLATEPENSQRIWCLILENTFTSIPDMAALLFGLKCLQYLPLFLYKN
KYLSILKVRSVTVPTLFISGLADTLVPPYMMQDLYKNCKSPCKKILSISG
GTHNETWCQPRYYKNICNFLNELRENPPIPVTSSHWQIDDI
|
|
|
|
