Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacam-q1rs60

Bacillus amyloliquefaciens polyketide synthase type I

Comment
C-term PfamA Abhydrolase_1 1087 1278


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus amyloliquefaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus amyloliquefaciens group: N E > Bacillus amyloliquefaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AJ634061
1 UniProt : Q1RS60
1 UniProt : Q1RS60
1 Interpro : Q1RS60
1 Prodom : Q1RS60
1 Pfam : Q1RS60
1 PIRSF : Q1RS60
1 SUPERFAM : Q1RS60
Sequence
Graphical view for this peptide sequence: bacam-q1rs60
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MEILMSGKGETILLICGFATTAYMWKEQMKEWADQFNVIVIHTPGYGLSE
GSADFTLSGLAQTFIEVLNEIGVAWPIHIAAASWGGMIGQRIAYEYPEKV
KTLILSGSYTAYEEDPESSVEEKLKNDFIAIGKSHEYESLYSNQFLNASI
ERFMKIHQQEGYSTIGFLKDIHTRTLILTGEKESVVDQKETKRLQKLLSN
AELKKIKGAGHLPNITHPEEFNKAVSEFIKKSVSKG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEILMSGKGETILLICGFATTAYMWKEQMKEWADQFNVIVIHTPGYGLSE
GSADFTLSGLAQTFIEVLNEIGVAWPIHIAAASWGGMIGQRIAYEYPEKV
KTLILSGSYTAYEEDPESSVEEKLKNDFIAIGKSHEYESLYSNQFLNASI
ERFMKIHQQEGYSTIGFLKDIHTRTLILTGEKESVVDQKETKRLQKLLSN
AELKKIKGAGHLPNITHPEEFNKAVSEFIKKSVSKG


Reference
    Title: Structural and functional characterization of three polyketide synthase gene clusters in Bacillus amyloliquefaciens FZB 42
    Chen XH, Vater J, Piel J, Franke P, Scholz R, Schneider K, Koumoutsi A, Hitzeroth G, Grammel N and Borriss R <3 more author(s)>
    Ref: Journal of Bacteriology, 188:4024, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer