Gene_locus Report for: bacan-Q81NX8Bacillus anthracis Uncharacterized protein Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus anthracis: N E
6_AlphaBeta_hydrolase : bacan-BA0160Bacillus anthracis (strain Ames) and Bacillus thuringiensis (subsp. konkukian) hypothetical protein, bacan-BA0954Bacillus anthracis, Bacillus thuringiensis, Lysinibacillus sphaericus, Bacillus cereus; Bacillus mycoides, Bacillus weihenstephanensis, Bifunctional nucleotide sugar epimerase/hydrolase mxaa domain protein, bacan-BA1747Bacillus anthracis (strain Ames) hydrolase, alpha/beta fold family, bacan-BA1914Bacillus anthracis (strain Ames) and Bacillus thuringiensis (subsp. konkukian) Bacillus cereus (strain ZK) hypothetical protein, bacan-BA2015Bacillus anthracis (strain Ames) hypothetical protein, bacan-BA2417Bacillus anthracis (strain Ames) hydrolase, alpha/beta fold family, bacan-BA2557Bacillus anthracis (strain Ames) hypothetical protein, bacan-BA2687 Bacillus anthracis (strain Ames) hydrolase, and Bacillus cereus (strain ATCC 10987) alpha/beta fold family, bacan-BA2865Bacillus anthracis (strain Ames) Bacillus cereus MM3 hypothetical protein, bacan-BA3068Bacillus anthracis (strain Ames) hypothetical protein, bacan-BA3187Bacillus anthracis (strain Ames) hydrolase, alpha/beta fold family, bacan-BA3343Bacillus anthracis (strain Ames) Bacillus thuringiensis (strain Al Hakam) (subsp. konkukian)Bacillus cereus (strain ATCC 10987)hydrolase, alpha/beta fold family, bacan-BA3372Bacillus anthracis (strain Ames) hypothetical protein, bacan-BA3877Bacillus anthracis (strain Ames) and Bacillus thuringiensis (subsp. konkukian) (strain Al Hakam) hydrolase, alpha/beta fold family, bacan-BA3887Bacillus anthracis (strain Ames)Bacillus cereus G9241 hydrolase, alpha/beta fold family. A85-IroE-IroD-Fes-Yiel : bacan-BA1242Bacillus anthracis, Bacillus thuringiensis, hypothetical protein, bacan-BA2694Bacillus anthracis (strain Ames)Bacillus thuringiensis serovar kurstaki str. T03a001 Bacillus cereus ATCC 10876 esterase, putative, bacan-BA3863Bacillus anthracis; Bacillus thuringiensis, Bacillus cereus, hypothetical protein. Aclacinomycin-methylesterase_RdmC : bacan-BA2738Bacillus anthracis, Bacillus thuringiensis, Bacillus cereus, hydrolase, alpha/beta fold family. AlphaBeta_hydrolase : bacan-BA1019Bacillus anthracis, Bacillus thuringiensis, Bacillus cereus, Bacillus thuringiensis hydrolase, alpha/beta fold family, bacan-BA3178Bacillus anthracis; Bacillus thuringiensis; Bacillus cereus; Bacillus weihenstephanensis hypothetical protein, bacan-BA4328Bacillus anthracis (strain Ames) hypothetical protein, bacan-BA4577Bacillus anthracis; Bacillus thuringiensis; Bacillus cereus; hydrolase, alpha/beta fold family. Bacillus_lip : bacan-q81tt2Bacillus anthracis. hypothetical protein. Bacterial_EstLip_FamX : bacan-BA1866Bacillus anthracis Bacillus cereus hypothetical protein. Bacterial_lip_FamI.5 : bacan-BA2607Bacillus anthracis, Bacillus thuringiensis, Bacillus cereus lipase, putative. BlEst2-lipase-like : bacan-a0a6l7h3w8Bacillus anthracis. Uncharacterized protein. Carbon-carbon_bond_hydrolase : bacan-BA5136Bacillus anthracis (strain Ames) Bacillus thuringiensis (subsp. konkukian) (strain Al Hakam) Bacillus cereus G9241 hydrolase, alpha/beta fold family. Homoserine_transacetylase : bacan-BA4983 Bacillus anthracis, Bacillus cereus, Homoserine O-acetyltransferase, putative. LYsophospholipase_carboxylesterase : bacan-BA3703Bacillus anthracis, Bacillus thuringiensis, Bacillus cereus, phospholipase/carboxylesterase family protein. MenH_SHCHC : bacan-BA5110Bacillus anthracis, Bacillus thuringiensis, Bacillus cereus, hydrolase, alpha/beta fold family. Monoglyceridelipase_lysophospholip : bacan-BA5009Bacillus anthracis, Bacillus cereus, Bacillus thuringiensis, Bacillus weihenstephanensis lysophospholipase l2 (EC 3.1.1.5). PAF-Acetylhydrolase : bacan-BA0950Bacillus anthracis (strain Ames) and Bacillus thuringiensis (subsp. konkukian)hypothetical protein. PC-sterol_acyltransferase : bacan-BA3805Bacillus anthracis prophage lambdaba01, acyltransferase, putative. Proline_iminopeptidase : bacan-BA2392Bacillus anthracis; Bacillus thuringiensis, Bacillus cereus, Bacillus weihenstephanensis, Bacillus mycoides, Proline_iminopeptidase, bacan-BA4324Bacillus anthracis, Bacillus thuringiensis, Bacillus cereus, hydrolase. Thioesterase : bacan-DHBFBacillus anthracis, Bacillus thuringiensis, Bacillus mycoides, Bacillus weihenstephanensis, nonribosomal peptide synthetase dhbf Thioesterase domain. UCP033634 : bacan-a0a1j9w4y5Bacillus anthracis; Bacillus sp.; Bacillus cereus Uncharacterized protein, bacan-a0a1j9wz46Bacillus anthracis Uncharacterized protein, bacan-a0a1t3uyy1Bacillus anthracis Alpha/beta hydrolase, bacan-a0a2a8lbn0Bacillus anthracis Alpha/beta hydrolase, bacan-a0a2a8wij7Bacillus anthracis; Bacillus cereus Alpha/beta hydrolase, bacan-a0a2b0y5d8Bacillus anthracis Uncharacterized protein, bacan-a0a2b8ijf1Bacillus anthracis Alpha/beta hydrolase Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Bacillus anthracis str. CDC 684: N, E.
Bacillus anthracis str. A0465: N, E.
Bacillus anthracis str. Ames: N, E.
Bacillus anthracis str. A0248: N, E.
Bacillus anthracis str. A0488: N, E.
Bacillus anthracis str. A0193: N, E.
Bacillus anthracis str. A0442: N, E.
Bacillus anthracis str. A0389: N, E.
Bacillus anthracis str. A0174: N, E.
Bacillus anthracis Tsiankovskii-I: N, E.
Bacillus anthracis str. A2012: N, E.
Bacillus anthracis str. BF1: N, E.
Bacillus anthracis str. SVA11: N, E.
Bacillus anthracis str. H9401: N, E.
Bacillus anthracis str. A16: N, E.
Bacillus anthracis CZC5: N, E.
Bacillus anthracis 8903-G: N, E.
Bacillus anthracis 9080-G: N, E.
Bacillus anthracis 52-G: N, E.
Bacillus anthracis str. A16R: N, E.
Bacillus anthracis str. UR-1: N, E.
Bacillus anthracis str. Tsiankovskii-I: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: bacan-Q81NX8
Colored MSA for UCP033634 (raw)
MKGTKKEIHINDKVIYYTHIEKGSSTVCFMFSGSGYNYDKPLFYYATMLM
LEKKIDVVHIHYSYDEQVMSKPIEEVTKVMMDDIHPIMNEVLKGDQYNEP
MFLGKSLGTIPIANDLMKRKEFLQSKMIVLTPLLTFESIFDSILHSSHEG
LLVIGDKDHHYNANQIDQLYKTNLKIDVIKNANHSVNVGGFETENSIEAI
AKVIEKLKEVVRPN
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MKGTKKEIHINDKVIYYTHIEKGSSTVCFMFSGSGYNYDKPLFYYATMLM
LEKKIDVVHIHYSYDEQVMSKPIEEVTKVMMDDIHPIMNEVLKGDQYNEP
MFLGKSLGTIPIANDLMKRKEFLQSKMIVLTPLLTFESIFDSILHSSHEG
LLVIGDKDHHYNANQIDQLYKTNLKIDVIKNANHSVNVGGFETENSIEAI
AKVIEKLKEVVRPN
|
|
