Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-c2t6y8

Bacillus cereus (strains BDRD-Cer4; Rock1-15; BDRD-ST24) Putative uncharacterized protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus cereus BDRD-Cer4
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E > Bacillus cereus BDRD-Cer4: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : ACME01000069, ACMH01000096, ACMB01000088
2 UniProt : C2T6Y8, C2UK17
2 UniProt : C2T6Y8, C2UK17
2 Interpro : C2T6Y8, C2UK17
2 Prodom : C2T6Y8, C2UK17
2 Pfam : C2T6Y8, C2UK17
2 PIRSF : C2T6Y8, C2UK17
2 SUPERFAM : C2T6Y8, C2UK17
Sequence
Graphical view for this peptide sequence: bacce-c2t6y8
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MRKGSDIMWKRQMIHTKRGTFELFTKGDGESLCITHHYSQFNETGDYFAD
VFTATHRVFLINLRDAGNSLKANSEKELSMIETIHDLEAIREALQLPTWH
FAGHSTGGMLGLLYAITYPHSLQSLVVAGAAASNYTETPFCIYHPAHPQF
HYMQKLIENLKSPHLTNEERKELSTKRTKLSLYKPENYNSYFCKPINKTM
SISRMNAFANEYPSFDLRENLPSIQTKTLIICGRYDVQCPIQYSIEIHDG
IRNSIFIPFENSNHYPFLEEAAQFTSTTQTFYKSLLPLLSIKTKH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRKGSDIMWKRQMIHTKRGTFELFTKGDGESLCITHHYSQFNETGDYFAD
VFTATHRVFLINLRDAGNSLKANSEKELSMIETIHDLEAIREALQLPTWH
FAGHSTGGMLGLLYAITYPHSLQSLVVAGAAASNYTETPFCIYHPAHPQF
HYMQKLIENLKSPHLTNEERKELSTKRTKLSLYKPENYNSYFCKPINKTM
SISRMNAFANEYPSFDLRENLPSIQTKTLIICGRYDVQCPIQYSIEIHDG
IRNSIFIPFENSNHYPFLEEAAQFTSTTQTFYKSLLPLLSIKTKH



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer