Gene_locus Report for: bacmy-a0a1s8g543Bacillus mycoides; Bacillus pseudomycoides; Bacillus cereus Uncharacterized protein Comment Other strains: Bacillus mycoides; Bacillus pseudomycoides DSM 12442; Bacillus cereus Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus mycoides: N E
A85-IroE-IroD-Fes-Yiel : bacmy-c3b6f1Bacillus mycoides (strains Rock3-17; Rock1-4) Bacillus pseudomycoides DSM 12442 Putative uncharacterized protein. Aclacinomycin-methylesterase_RdmC : bacmy-c3aly3Bacillus mycoides (strains Rock1-4 Rock3-17) Bacillus pseudomycoides DSM 12442 Putative uncharacterized protein. BioH : bacmy-c3aq75Bacillus mycoides (strains Rock1-4; Rock3-17) Bacillus pseudomycoides DSM 12442 Biotin biosynthesis protein. DPP4N_Peptidase_S9 : bacmy-c3alg1Bacillus mycoides Peptidase S9B, dipeptidylpeptidase IV domain protein. HNLyase_Bact : bacmy-c3akr1Bacillus mycoides (strains Rock1-4; Rock3-17) Bacillus pseudomycoides DSM 12442 Salicylate esterase. Proline_iminopeptidase : bacmy-c3aae7Bacillus mycoides, Bacillus cereus, Bacillus weihenstephanensis, Putative uncharacterized protein. UCP033634 : bacmy-a0a090yuj3Bacillus mycoides Uncharacterized protein, bacmy-a0a0a0wld7Bacillus mycoides; Bacillus sp.; Bacillus cereus BDRD-ST196 Uncharacterized protein, bacmy-a0a109g9d2Bacillus mycoides; Bacillus sp. Uncharacterized protein, bacmy-a0a1c3taf9Bacillus mycoides; Bacillus cereus Uncharacterized protein, bacmy-a0a1c4e0s2Bacillus mycoides; Bacillus cereus Uncharacterized protein, bacmy-a0a1d3nb43Bacillus mycoides; Bacillus cereus Uncharacterized protein, bacmy-a0a1s9tbz6Bacillus mycoides; Bacillus sp. Alpha/beta hydrolase, bacmy-a0a1s9xtx5Bacillus mycoides Alpha/beta hydrolase, bacmy-a0a1w6a9x2Bacillus mycoides; Bacillus cereus Alpha/beta hydrolase, bacmy-a0a1x6q7g7Bacillus mycoides; Bacillus sp.; Bacillus cereus Uncharacterized protein, bacmy-a0a1x6qa00Bacillus mycoides Uncharacterized protein, bacmy-c2xvs2Bacillus mycoides; Bacillus cereus Uncharacterized protein, bacmy-j8hrd9Bacillus mycoides Uncharacterized protein Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Bacillus weihenstephanensis KBAB4: N, E.
Bacillus mycoides DSM 2048: N, E.
Bacillus mycoides Rock3-17: N, E.
Bacillus weihenstephanensis: N, E.
Bacillus mycoides Rock1-4: N, E.
Bacillus weihenstephanensis FSL R5-860: N, E.
Bacillus weihenstephanensis NBRC 101238 = DSM 11821: N, E.
Bacillus mycoides FSL H7-687: N, E.
Bacillus pseudomycoides DSM 12442: N, E.
Bacillus pseudomycoides: N, E.
Bacillus cereus VD136: N, E.
Bacillus cereus VDM006: N, E.
Bacillus cereus VDM021: N, E.
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
1 Genbank : WP_016114138>3 UniProt links 1 more: A0A1S8G543, A0A2H3MI58, C3BLC3<4 UniProt links 1 less: A0A1S8G543, A0A2H3MI58, C3BLC3, R8PAV0>3 Interpro links 1 more: A0A1S8G543, A0A2H3MI58, C3BLC3<4 Interpro links 1 less: A0A1S8G543, A0A2H3MI58, C3BLC3, R8PAV0>3 Pfam links 1 more: A0A1S8G543, A0A2H3MI58, C3BLC3<4 Pfam links 1 less: A0A1S8G543, A0A2H3MI58, C3BLC3, R8PAV0>3 PIRSF links 1 more: A0A1S8G543, A0A2H3MI58, C3BLC3<4 PIRSF links 1 less: A0A1S8G543, A0A2H3MI58, C3BLC3, R8PAV0>3 SUPERFAM links 1 more: A0A1S8G543, A0A2H3MI58, C3BLC3<4 SUPERFAM links 1 less: A0A1S8G543, A0A2H3MI58, C3BLC3, R8PAV0
|
Sequence Graphical view for this peptide sequence: bacmy-a0a1s8g543 Colored MSA for UCP033634 (raw)
MKGNKKEIHINDKVIRYTHIEKGSKTICFMFSGSGYNYDKPLFYYSTMVM
LQNKIDVVHIHYSYDEQIMKNNIEEITKIMMDDINPVIFEVLKNGQYNNS
MFLGKSLGTIPIANDLMKREEYLQSKMILLTPLMTFDAILDSILNSHQEG
FLVIGDKDHQYNSNQIDQLSKMNLKIDVVKNANHSLNVGEFETANSILAL
SRVMEKLQETVRTN
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MKGNKKEIHINDKVIRYTHIEKGSKTICFMFSGSGYNYDKPLFYYSTMVM LQNKIDVVHIHYSYDEQIMKNNIEEITKIMMDDINPVIFEVLKNGQYNNS MFLGKSLGTIPIANDLMKREEYLQSKMILLTPLMTFDAILDSILNSHQEG FLVIGDKDHQYNSNQIDQLSKMNLKIDVVKNANHSLNVGEFETANSILAL SRVMEKLQETVRTN
|
|
|