Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bactu-a0a2t7yhx0

Bacillus thuringiensis; Bacillus wiedmannii; Bacillus cereus; Bacillus bombysepticus; Streptococcus pneumoniae; Bacillus sp. Alpha beta hydrolase

Comment
Other strains: Bacillus thuringiensis serovars (londrina; subtoxicus; toumanoffi; pirenaica; yosoo; huazhongensis BGSC 4BD1); Bacillus wiedmannii; Bacillus cereus (Rock1-15; Rock4-2; BAG4O-1 HuB13-1); Bacillus bombysepticus str. Wang; Streptococcus pneumoniae; Bacillus sp.


Relationship
Family|UCP033634
Block| X
Position in NCBI Life Tree|Bacillus thuringiensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus thuringiensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 12 more: WP_000679158, WP_000679151, WP_046946123
>3 UniProt links 27 more: A0A023P8X9, A0A0F6FQ85, A0A0J7JFV9
>3 Interpro links 27 more: A0A023P8X9, A0A0F6FQ85, A0A0J7JFV9
>3 Pfam links 27 more: A0A023P8X9, A0A0F6FQ85, A0A0J7JFV9
>3 PIRSF links 27 more: A0A023P8X9, A0A0F6FQ85, A0A0J7JFV9
>3 SUPERFAM links 27 more: A0A023P8X9, A0A0F6FQ85, A0A0J7JFV9
Sequence
Graphical view for this peptide sequence: bactu-a0a2t7yhx0
Colored MSA for UCP033634 (raw)
MYSEGKMVKGTKKEVHINDKVIYYTHIEQGSSTVCFMFSGSGYNYDKPLF
YYATMLMLEHKIDVVHIHYSYDGQLMNKPMEEVTKVMMDDINPVINEVLK
DEQYNETMFLGKSLGTIPIANDLMKREEFAQSKMILLTPLLTFDTIFDSI
LHSRHEGFLVIGDKDHQYNADQIDQLYKTNLQIEVVKNANHSVNVGGYET
ENSIEAIAKIIGKLKEVVRTN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYSEGKMVKGTKKEVHINDKVIYYTHIEQGSSTVCFMFSGSGYNYDKPLF
YYATMLMLEHKIDVVHIHYSYDGQLMNKPMEEVTKVMMDDINPVINEVLK
DEQYNETMFLGKSLGTIPIANDLMKREEFAQSKMILLTPLLTFDTIFDSI
LHSRHEGFLVIGDKDHQYNADQIDQLYKTNLQIEVVKNANHSVNVGGYET
ENSIEAIAKIIGKLKEVVRTN



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer