Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burce-a0a095fwn4

Burkholderia cepacia (Pseudomonas cepacia). Cutinase family protein

Comment
Other strains: Burkholderia cepacia (Pseudomonas cepacia; Burkholderia sp.


Relationship
Family|VirJ
Block| X
Position in NCBI Life Tree|Burkholderia cepacia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia cepacia: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: JPGD01000006, WP_034204737, WP_059505412
1 UniProt : A0A103AVT0
1 Interpro : A0A103AVT0
1 Prodom : A0A103AVT0
1 Pfam : A0A103AVT0
1 PIRSF : A0A103AVT0
1 SUPERFAM : A0A103AVT0
Sequence
Graphical view for this peptide sequence: burce-a0a095fwn4
Colored MSA for VirJ (raw)
MMLKKVIARAAAACAGMMLAGAACAAQPAAAKAETVSGGRYGPVTVTRPS
GPLRGFVVLFSRGAGWQAADQQAADALAQAGAMTVGVDSGRYAANLAAKQ
EACHHLDGDAEAVSHQLERLAQSSRYFTPIVAGVGQGGAIAKQILSMAPE
NTIAGVVAVEPAAKLDPRFKPCPPDPTIVRRAMPGFVETAAAGDSAKLVS
LVTSHLRDTSSSDELDVSDLPLVELPAKGGSDRLAIVISGDGGWRDLDKT
IAEALQRDGVSVVGIDSLRYFWSEKPPAQVSRDLARVMRTYMARWHASRV
ALVGYSFGADVMPFAYNRLPADLRDKVAVMSLLGFAPSADFQIRVTGWLG
MPASDKALKVAPEIAKVPPQRVQCFYGAQESDTMCPALANTGADVIKTEG
DHHFGRDYIALEKKILGAFGKPAAAH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMLKKVIARAAAACAGMMLAGAACAAQPAAAKAETVSGGRYGPVTVTRPS
GPLRGFVVLFSRGAGWQAADQQAADALAQAGAMTVGVDSGRYAANLAAKQ
EACHHLDGDAEAVSHQLERLAQSSRYFTPIVAGVGQGGAIAKQILSMAPE
NTIAGVVAVEPAAKLDPRFKPCPPDPTIVRRAMPGFVETAAAGDSAKLVS
LVTSHLRDTSSSDELDVSDLPLVELPAKGGSDRLAIVISGDGGWRDLDKT
IAEALQRDGVSVVGIDSLRYFWSEKPPAQVSRDLARVMRTYMARWHASRV
ALVGYSFGADVMPFAYNRLPADLRDKVAVMSLLGFAPSADFQIRVTGWLG
MPASDKALKVAPEIAKVPPQRVQCFYGAQESDTMCPALANTGADVIKTEG
DHHFGRDYIALEKKILGAFGKPAAAH



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer